SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000962 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000962
Domain Number 1 Region: 52-287
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.99e-90
Family Calponin-homology domain, CH-domain 0.00000226
Further Details:      
 
Domain Number 2 Region: 2326-2444
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-31
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 304-424
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-29
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 433-535
Classification Level Classification E-value
Superfamily Spectrin repeat 6.72e-23
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 5 Region: 1621-1723
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-21
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 6 Region: 1780-1929
Classification Level Classification E-value
Superfamily Spectrin repeat 5.01e-21
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 7 Region: 1888-2043
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-21
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 8 Region: 840-978
Classification Level Classification E-value
Superfamily Spectrin repeat 3.19e-19
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 1306-1408
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-17
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 10 Region: 2014-2108
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 11 Region: 1083-1198
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000301
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 12 Region: 1166-1279
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000537
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 13 Region: 526-607
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000374
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 14 Region: 1377-1474
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000929
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 15 Region: 1479-1563
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000023
Family Spectrin repeat 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000962
Domain Number - Region: 964-1075
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00137
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000962   Gene: ENSFCAG00000001033   Transcript: ENSFCAT00000001033
Sequence length 2481
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:13547747:13622348:-1 gene:ENSFCAG00000001033 transcript:ENSFCAT00000001033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVPGEVDNMEGLPAPNNNNPAARWESPDRGWEREQPAAATAAASLFECSRIKALADER
EAVQKKTFTKWVNSHLARVGCHIGDLYADLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHS
LENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRET
RSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANY
NLQRAFRTAEQHLGLTRLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGK
VLDQVLEVGKIIERYEELAAELLAWIHRTVGLITNQKFANSLSGVQQQLQAFTAYCTLEK
PVKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGQLEKAEHEREAALRA
ELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA
AYEERVQGVAELAQALAAEGYYDARRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQK
IFQEMVYMVDWMEEMQAQLLSRECGQHLVEAEDLLQKHGLLEGDIAAQSERVEALNAAAL
RFSQLQGESGVGDWAGSNKVLILLCLSQSSEGLGLACLTPVSGATALWNLEASVEKARPI
WLARWCVCWGGGGGGGSHPHGLGQMLKSPSKPQWDMPTLAQPLLPTSKPRDRLIETLSFL
RLLLSSPCEILVPGGGQQHHKNSKEANVCCHGDRREQCLISGPECVWIHGCLLLLIIQVD
ALVFGSISVNVQNSRNGVSHNQKSRRKVKSSLKLREKATEDERGNPENGLRRDVSFGPVL
KETQQRTDRAGSLYXEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGEKEQWLLAMRV
PDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQELVEGGHPSSDEVRSCQDHLNSSN
PPPRWNRIVELVEQRKEEVSAVLLVENHVLEVAEVRAQVREKRRAVESAPRAGGALQWRL
SGLEAALQALEPRQAALQEEAALLAVRFPAQAARLHQGAEELGAEWGALASAAQACGEAV
AAAGRLQRFLHDLDAFLDWLVRAQEAAGGVEGPLPGSLEEADALLARHAALKEEVDQREE
DYARIVAASEALLAADGAELGPGLALDEWLPHLELGWHKLLGLWEARREALVQAHVYQLF
LRDLRQARAVLRNQEVALSGLELPGTVESVEEALKRHRDFLTTMELNQQKMQVAVQAAEG
LLRQGNAYGEQAQEAVTRLLEEAHMSQENQLRAQQWMQKLHDQLGLQHFLRDCHELDGWI
HEKMLMARDGTREDGHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAASV
RKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFVELDKKLLHMESQLQDVDPGGD
LATVNSQLKKLQSMESQVEEWYREVGELQAQTAALPLEPASKELVGERQNAVGERLVRLL
EPLQERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGSGLQAVQQYIKKNQVSR
ARVTKEGTRLFSHLQHGGVSERVTANCFRGTCRKVEGYLRGGGVGGWGERRQQVLDAAFQ
VEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLSR
QCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSLEQQYWLYQLSRQVDELEHW
IAEKEVVAGSPELGQDFEHVTVLQEKFSEFASETGTAGRERLAAVNQMVDELIECGHTAA
ATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRLTA
PPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEVLQ
GWKELLAACEDARLHVSSTADALRFHSQARDLLSWMDGIAGQIGAADKPRDVSSVEVLMN
YHQGLKTELEARVPELTACQELGRSLLLNKSAMADESQAQLDKLGTRKEEVSEKWDRHWE
WLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEE
RFSSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLAR
RASDTLSAEVPADQPEEAARRRRPERQESADHEAAHSLTLGRYEQMERRRERRERRLERQ
ESSEQEMPTRGELAKGKATLADIVEQLQEKEAGPGLPVGPSLPQPRELPPGRLPNGLEPP
ERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRSAPAQGGSAPAPPPPPTHTVQHEG
FLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDAKGPASGGTHGGEPLLSLHKATSE
VASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVAASVGEHAEIARWGQTLPTTS
STDEGNPKREAGERRASGRRK
Download sequence
Identical sequences ENSFCAP00000000962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]