SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000981 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000981
Domain Number 1 Region: 262-405
Classification Level Classification E-value
Superfamily Cyclin-like 3.93e-18
Family Cyclin 0.014
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000981
Domain Number - Region: 4-128
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0225
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000981   Gene: ENSFCAG00000001056   Transcript: ENSFCAT00000001056
Sequence length 423
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:1565608:1571974:1 gene:ENSFCAG00000001056 transcript:ENSFCAT00000001056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPQPPPPPDSLRTDVPRPGHSPPAGGCPPPPPAPSLSGVLCPVPPPTPVSSPGARPQLTR
RVASQRCSLEFLEDAVGCASVQRTKHISGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICA
KRSLCAAFSVLPYGEGLRVSDLRVDGQKQRHPSGGVSVSSEMVFELEGVELGADGKVVSY
AKFLYPTNALVTHKTDIHGLPPQPRPSIPRALPGSRYKPTPAKSAPAGTDLGTDAGDTLE
YNPNLLDDPQWPCGKHKRVLIFASYMTTVIEYVKPSDLKKDMNETFREKFPHIKLTLSKI
RSLKREMRNLSEECSLEPVTVSMAYVYFEKLVLQGKLNKQNRKLCAGACVLLAAKISSDL
RRSEVLPPPSLLPPPVQKLEERFRFNRRDLIGFEFTVLVALELALYLPEGQVLPHYRRLT
QQF
Download sequence
Identical sequences ENSFCAP00000000981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]