SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000994 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000994
Domain Number 1 Region: 25-177
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.96e-40
Family Multidomain sulfurtransferase (rhodanese) 0.000000295
Further Details:      
 
Domain Number 2 Region: 169-303
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.19e-32
Family Multidomain sulfurtransferase (rhodanese) 0.000000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000994   Gene: ENSFCAG00000001069   Transcript: ENSFCAT00000001069
Sequence length 314
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:133151233:133162623:-1 gene:ENSFCAG00000001069 transcript:ENSFCAT00000001069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSFPGFHPRQVMRRAETMVHQVLYRALVSTKWLAESVRAGKLGPGLRVLDASWYSPGTRE
ARKEYLERHVPGASFFDMEECRDAASPYEMMLPSEADFARYVGRLGISNQTHVVVYDGDH
LGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPANFEATLDRSLLK
TYEQVLENLESKRFQLVDARSQGRYLGTEPEPDAVGLDPGHIRGSVNMPFVDFLTEDGFE
KSPEELRALFEAKKVNLAQPLIATCRKGVTACHIALAAYLCGKPDVAIYDGSWFEWFHRA
PPETRVSQWQRGKA
Download sequence
Identical sequences ENSFCAP00000000994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]