SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001059 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001059
Domain Number 1 Region: 24-201
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.44e-53
Family MHC antigen-recognition domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 205-295
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-20
Family C1 set domains (antibody constant domain-like) 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001059   Gene: ENSFCAG00000001141   Transcript: ENSFCAT00000001143
Sequence length 332
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:65284711:65287394:-1 gene:ENSFCAG00000001141 transcript:ENSFCAT00000001143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSLQVTLLAALLLGGHGARAAQEPLSFHVAHIFSFANQSWAQHQGSGWLGDMQTHGWDS
ESGTIIFLRSWSKGNFSDEELIDLELLFRVYFIGLTRETEEYADQLHLTYPMEIQVAAGC
ELHSSDIAKGFLRAAYQGSDFLSFQNMSWVPSLKSDSRAQSACDLMNQYEAIRETVHSLT
ANTCPRFALGLFDAGKVDLQKQVRPVAWLSSGPSPGPGRLLLVCHVSGFYPKPVWVMWMR
GEQEQQGTRRGDVLPHADGTWYLQVTLDVVAQEAAGLSCRVRHSSLGGRDMVLYWGHHLS
MYLILLAVTVPLILLIVVALWFKKRCSYQDIP
Download sequence
Identical sequences ENSFCAP00000001059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]