SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001182 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001182
Domain Number 1 Region: 105-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000165
Family EGF-type module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001182   Gene: ENSFCAG00000001273   Transcript: ENSFCAT00000001273
Sequence length 208
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:117063921:117074105:-1 gene:ENSFCAG00000001273 transcript:ENSFCAT00000001273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLPSVVLKVFLAAVLSALVTGESLERLRRGLAAGTSNLDSPTESTDQLLPSGGSRGRE
VLDLEETDLDLFRAAFSSKPQPLVTPSKEERGKKKKKGKGLGRKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTVLAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTTSH
Download sequence
Identical sequences M3VWC1
XP_003980879.1.62641 XP_006927718.1.62641 XP_019279924.1.44245 ENSFCAP00000001182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]