SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001340 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001340
Domain Number 1 Region: 127-207
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000406
Family Second domain of FERM 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001340   Gene: ENSFCAG00000001443   Transcript: ENSFCAT00000001443
Sequence length 465
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:109969397:109988861:1 gene:ENSFCAG00000001443 transcript:ENSFCAT00000001443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGTEGNAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLNAHELHRA
VREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTDAPDDDVAMDE
PSLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQL
GPYQPGQPTACAVREKLDSFLPAHLCKRGHGLFAALRGRGAKAGPGEQGLLNAYCKVKEA
AGGDSGRGASLSTHYRAYLLKSHELPFYGCAFFHGEVDKPAQGFLHRAGRKPVVVAISLE
GVHVIDSREKHVLLGLRFQELSWDHTSPEEEESVLWLEFDGDNEGTPVNRLLKIYSKQAE
LMSGLIEHCIELNQTSELAAPQEPVSGPPSAASSLPSSAQRPQLQRQGSVVCSRLQHLST
IDYVEEGQQIKRVKPKRTTSFFSRQLSMGQGSYTVVQPADSLEQG
Download sequence
Identical sequences M3VWN0
XP_003993642.1.62641 ENSFCAP00000001340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]