SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001365 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001365
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-39
Family SCAN domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 231-292
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000183
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 
Domain Number 3 Region: 415-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000429
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001365   Gene: ENSFCAG00000001471   Transcript: ENSFCAT00000001471
Sequence length 467
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:20556108:20561380:-1 gene:ENSFCAG00000001471 transcript:ENSFCAT00000001471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRRFRYQEAASP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEETVHPGAEPESPNELQNAVQTSTPEESHEETTQ
SPDLGPPEEPSVCHELEFQPLQQSELPVPQGPDLPEERSPGNPEMVAFLTALSQGLVTFK
DVAVCFSQDQWSDMDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDEISHVREEEPLVPDI
PEPQEPQEPEILSFTYTGDRSEDEEEYLEQEDDIHRSILGDPEIHQTPDWEIVFEDDPSR
PNERSFGTNTSQVNSLSNLRETMPICPLVHKMGTAYKFPLNRKNLDETSPLVQRYLAHRK
THAAEELYLCSECGRCFNHSAAFAKHLRGHASGPTQKRPPSSVPVGG
Download sequence
Identical sequences ENSFCAP00000001365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]