SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001376 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000001376
Domain Number - Region: 82-197
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0863
Family Formin homology 2 domain (FH2 domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001376   Gene: ENSFCAG00000001482   Transcript: ENSFCAT00000001482
Sequence length 542
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:88251007:88258792:1 gene:ENSFCAG00000001482 transcript:ENSFCAT00000001482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKKATKGTKEPEVKKKKGGKKDASMGSKPAETPLGEEMREFYHIQIRDLEDRLARYQ
RKWDELAVQEKLFRQEFEQLANNKKEIVAFLKRTLNQKVDEITELNEQLQSLQLAKEVEK
DAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKEELTEKFTTLEDQLRKQE
GDYKDYVYNLEKKSVLDKDRLRKEIIQRVNLVATEYRKVATSQMWDTTKRAIVENNTVTL
QLSKISRQGAQLLQENEQLKGTRDELCKQLDLLENAQKVMARHSRGHRKIILMLTEKCRE
QQRGTVEAEQLRLQLSQLEQGLGQLQQDTQTLRSQRDQLNLQLERQQAEAQQLQRELTEE
QKVRANLEAALAQATFILQDVLQMQPDEGDSDSDVVFQLQLKETLHQVLAVLSSAVVLSP
RLAVYLNQESQAHSPPKGSQPGTQPPKMGSLRQPPSSIAPYQPGDLGLVPRRAHIPPNPE
DLRLLSHTTRVGTFRVHSSPEIHTSGSPKRFKKFSLPEVSLLSNAGRAPRCPPHPDAAPG
AP
Download sequence
Identical sequences ENSFCAP00000001376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]