SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001428 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001428
Domain Number 1 Region: 349-608
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.91e-65
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 196-302
Classification Level Classification E-value
Superfamily Kringle-like 2.39e-31
Family Kringle modules 0.00055
Further Details:      
 
Domain Number 3 Region: 36-90
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-18
Family Fibronectin type II module 0.0032
Further Details:      
 
Domain Number 4 Region: 96-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000431
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001428   Gene: ENSFCAG00000001538   Transcript: ENSFCAT00000001538
Sequence length 609
Comment pep:known chromosome:Felis_catus_6.2:A1:173152216:173160270:1 gene:ENSFCAG00000001538 transcript:ENSFCAT00000001538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLFLGSLLGSLESAFLTPPWKAPKEHEHRADEHTVVLTVTGEPCYFPFQYNRQLYHT
CIHKGRPGRQPWCATSPNFEQDQQWAYCLEPKKVKDHCSKHSPCQNGGTCVNMPKGPHCI
CPEHFTGKHCQREKCFEPQLFQFFHEKETWHRLESAGVAECQCKGPDAHCKPLASQVCHT
NPCLNGGSCLEAEGHRLCRCRAGYAGRFCDVDTEARCYDGHGLDYRGTAETALSGARCQP
WASEATYRNVTAEQALNWGLGDHAFCRNPDNDTRPWCFVWSGDRLSWEYCRLARCEPPVL
EALQFLPPTQVPSEHPDFPLPSLSALQKPQPPTPALGATPEQPTPLPSPSCGQRLRKRLS
SLSRVVGGLVALPGAHPYIAALYWRHNFCAGNLIASCWLAFPRIPSAHRPPPEELTVVLG
QDRHNQSCEQCQTLAVRAYRLHEAFSPITYQHDLALLRLQEREDGHCALPSPFVQPVCLP
SSAARPAEAEAALCEVAGWGHQFEGAGEYSSFLQEAQVPLIPSERCSAQDVHGVSFTSGM
LCAGFLEGGTDACQGDSGGPLVCEEEAAEHQLVLRGIVSWGSGCGDRYKPGVYTDVASYL
AWIQEHTNS
Download sequence
Identical sequences ENSFCAP00000001428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]