SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001615 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001615
Domain Number 1 Region: 153-262,308-579
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-149
Family Myotubularin-like phosphatases 0.0000000285
Further Details:      
 
Domain Number 2 Region: 1119-1197
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 52-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000932
Family GRAM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001615   Gene: ENSFCAG00000001744   Transcript: ENSFCAT00000001744
Sequence length 1204
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:21200946:21260841:1 gene:ENSFCAG00000001744 transcript:ENSFCAT00000001744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYVGRAEDAIIALSNYRL
HIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQEWLKRLNNAIRP
PAKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISN
INEKYKLCGSYPQELIVPAWITDKELESVASFRSWKRIPAVVYRHQSNGAVIARCGQPEV
SWWGWRNADDEHLVQSVAKACASDSRSSGSRLSTRNSSRDFPNAGDLSDVEFDSSLSNAS
GAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRRSFQ
SLRLLCTQMPDPGNWLSALEGTKWLHHLSVLLKSALLVVHAVDRDQRPVLAHCSDGWDRT
PQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWL
DCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLL
RAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPSTPVDDSCAPYPAPGTSP
DDPPLSRLPKTRSFDNLTTACDNTVPLANRRSSDPSLNEKWQEHRRSLELSSLAGPGEEP
LDPDNLGKPTKVLGGAELSVAAGVAEGQMENILQEATKEESGIEEPAHRGSIEMQEVEEE
ALLGKEIRGKTLEGSTIILPQEPELGDAALTNHPGTSLSLFSQGIPEQQGGLSILPCSLQ
ESPRGERTHEVPVEQPRIGAITEDREEAFLPIPVDVKVGYGTSQSSSLLPSQVPFEATGP
NTDSSMDMLMEGQVKSESGPEGHHRPCLVNSGWFSSKDILPQATEPQSSERSLAERPQVG
SVVHRTSPGSTHSPTRSPCALPLAECKEGLVCNGALETENKALEQPPGFSTLQKHPTPNG
HCTNGEAGRSKDSLSRQLSATSCSSAHLHSRNLHHKWLHGHSGRPSTTGSPDQPSRSHLD
DDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQELRSRLESQYLTSSLRFNGDFGDEVT
SIPDSESNLDQNCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDHLAAHCYACDSAFWLAS
RKHHCSSRNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELDKPIA
ATSN
Download sequence
Identical sequences ENSFCAP00000001615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]