SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001806 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001806
Domain Number 1 Region: 874-1147
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-68
Family Protein kinases, catalytic subunit 0.00000809
Further Details:      
 
Domain Number 2 Region: 567-851
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-48
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 3 Region: 147-280
Classification Level Classification E-value
Superfamily Second domain of FERM 7.22e-16
Family Second domain of FERM 0.0039
Further Details:      
 
Domain Number 4 Region: 433-547,577-602
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000161
Family SH2 domain 0.0044
Further Details:      
 
Domain Number 5 Region: 364-424
Classification Level Classification E-value
Superfamily PH domain-like 0.00000148
Family Third domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001806   Gene: ENSFCAG00000001953   Transcript: ENSFCAT00000001953
Sequence length 1155
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:52538622:52665573:-1 gene:ENSFCAG00000001953 transcript:ENSFCAT00000001953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRMITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHPDDSGNILYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKWKKLENKHKKDEEKNKIRE
EWNNFSYFPEITHIVIKECVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHH
YLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTC
FEKSEEWQVVGSLKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMNHLKKQILRTDNISFV
LKRCCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDRILKKDIVQGEHLGRGTRTHIYS
GTLLDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVR
DVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKN
LLLAREGIDSEFGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSF
GTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFR
AIMRDINKLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGD
NTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFL
PSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKI
GDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCD
SDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPANR
TTFQNLIKGFEALLE
Download sequence
Identical sequences ENSFCAP00000001806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]