SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001860 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001860
Domain Number 1 Region: 207-321
Classification Level Classification E-value
Superfamily ARID-like 1.06e-35
Family ARID domain 0.00000215
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000001860
Domain Number - Region: 10-18
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00523
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001860   Gene: ENSFCAG00000002012   Transcript: ENSFCAT00000002012
Sequence length 557
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:33648267:33702607:-1 gene:ENSFCAG00000002012 transcript:ENSFCAT00000002012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLQQQKQPPPPPPPPPHLAPLQMDAREKQGQQMREAPFLYAQKLVAQQTLLSATPGRS
SGSPALGPLARVPPATAVARVFERSNVNSEPEEEEGGLEDEDGDDEVAEVAEKEAQAPSK
YFHVQKVVRQDPRAAPVSGLLPAPGLPPRGQQAKEDHTKDASKAPPSVSTAGQPSWNLDE
QLKQNGGLAWSDDADGGRGREISRDFAKLYELDGDPERKEFLDDLFVFMQKRGTPINRIP
IMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLY
AYECEKKALSSPAELQAAIDGNRREGRRPSYSSSLFGYSPAAATAATAGAPALLSPPKIR
FPILGLGSSSGANASSPRISPATTLRKGDGVPVTTVPVPNRLAVPVTLAGQQAGPRTAAL
EQLRERLESGEPPEKKASRLSEEEQRLVQQAFQRSLLSMARQLPMKIRINGREDRTEASA
AALNLATGSIGSINMSVDIDGTTYAGVLFAQKPVVHLIAGSAAQSMGGSGSGSSHCSASP
TSSRGTPSAEPSTSWSL
Download sequence
Identical sequences XP_019687614.1.62641 ENSFCAP00000001860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]