SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001901 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001901
Domain Number 1 Region: 1237-1344
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-33
Family PDZ domain 0.00000453
Further Details:      
 
Domain Number 2 Region: 1643-1820
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.24e-29
Family Nucleotide and nucleoside kinases 0.00012
Further Details:      
 
Domain Number 3 Region: 1396-1493
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-17
Family PDZ domain 0.0073
Further Details:      
 
Domain Number 4 Region: 500-612
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-16
Family PDZ domain 0.0022
Further Details:      
 
Domain Number 5 Region: 626-696
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-16
Family PDZ domain 0.023
Further Details:      
 
Domain Number 6 Region: 1500-1567
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000564
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001901   Gene: ENSFCAG00000002056   Transcript: ENSFCAT00000002056
Sequence length 1823
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:40300170:40376580:-1 gene:ENSFCAG00000002056 transcript:ENSFCAT00000002056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSTYSVLSIMPSDSESSSSLSSVAPPGTTGKAPSPPPLLPDRQVNEKVENLSIQLRLMTR
ERNELRKRLAFATHGTTFDKRPYHRLNPDYERLKIQCVRAMSDLQSLQKQHTNALKRCEE
VAKETDFYHTLHSRLLSDQTQLKDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKE
IGDLRAQQQQVLKHNGSSEILNKLYDTAMDKLEVVKKDYDALRKRYSEKVAIHNSDLSRL
EQLEEENQRLLKQTEMLTQQRDTAIQLQHQCALSLRRFEAIHHELNKATAQNKDLQWEME
LLQSEMTELRTMQLKMAKESEKYKEERDAVYSEYKLIMSERDQVISELDKLQTEVELAES
KLKSSTSEKKAASEEMEALRQMKDTVTMDAGRANKEAEILRKQCKALCQELKEALQEADV
AKCRRDWAFQERDKIVAERDSIRTLCDNLRRERDRAVSELAEALRSLDDTRKKKNDVSRE
LKELKEQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEIVEFERETEDIDLKALGFD
MAEGVNEPCLPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLINKDKKQAIKALLNG
EGAINMVVRRRKSLGGKVVTPLHINLNGQKDSGICLENGVYAAAVMPGSPAAKEGSLAVG
DRIVAINGIALDNKSLNECESLLRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDKML
SIRAHGTEVQAQNKRSLLQHNNSTQTDIFYADRLEERREPGPPGGSSSFLHKPFPAGPFP
VSPQACPSASERSLSSFRSDTSGERGYGLVDVRSRRPLLPFDTEGGPCGAAEAPLDKTEP
ESSSSGGTWPKAVLGSAAGPEKLSVYKKPKQRKSIFDPNTFKRPQTPPKIDYLLPGPGSA
HSPQTSKRVGPLTPPKPPRRSDSIKFQHRLETSSESEATLVGSSPSASPPSALPPGVDPG
ELTHTSPPRKARVRIASSYYPEGDGDSSYLPAKKSCDGDLTSQKMDELGQKRRRPKSAPS
FRPKLAPVVIPAQFLEEQKCVPAGGELCPELQEWSPYSPGHPSRHSNPPFYPGRASVGTV
PRSMTPSTTVSSILRNPIYTVRSHRVGPCSSPPVPREVGPQGLHPSVQHQGRLSLDLSHR
TGSDYSEMRTSHGSNSLPSSARLGSSSNLQFKAERIKIPSTPRYPRSVVGSDRGSLSHSE
CSTPPQSPLNIDTLSSCSQSQTSASTLPRIAVNPAALGERRKDRPYVEEPRHVKLQKGSE
PLGISIVSGEKGGVYVSKVTGGSIAHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQC
DTITILAQYNPHMHQLSCHSRSSSHLDPVGTHSTLQGSSATSPEHPSVIDPLMEQDEGPG
APPAKQSTPSSRMVGEANKKTPEPRLVFIKKSQLELGVHLCGGNLHGVFVAEVEDDSPAK
GPDGLVPGDLILEYGSLDMRGKTVEEVYVEMLKPKDGVRLKVQYRPEEFTKVKSLPGDSF
YIRALYDRLAEVEHELSFKKDDILYVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYV
MDQEFSRRLSMSEVKDDNNATKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDTFSNDT
IPLFEDSVSLAYQRVQKVDCTSLRPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQ
QAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDISPHAIERLHHMHIYPI
VIFIHYKSAKHIKEQRDPIYLKDKVTQRHSKEQFETAQKIEQEYSRYFTGVIQGGALSSI
CTQILAMVNQEQNKVLWIPACPL
Download sequence
Identical sequences ENSFCAP00000001901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]