SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001930 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001930
Domain Number 1 Region: 126-188
Classification Level Classification E-value
Superfamily RING/U-box 1.67e-16
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000001930
Domain Number - Region: 111-120
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.017
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001930   Gene: ENSFCAG00000002088   Transcript: ENSFCAT00000002088
Sequence length 319
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:86325570:86327856:1 gene:ENSFCAG00000002088 transcript:ENSFCAT00000002088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGAVSFVLSRMAACGGTCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDI
YVLQLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLVPPPPPPLPPP
LPPRLREETEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMCGRFYGQ
LVGNQPQNGRMLVSKDATLLLPSYEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAY
LPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTTGRPNVITWNDIHHKTSCTGGPQLFGYPD
PTYLTRVQEELRAKGITDD
Download sequence
Identical sequences ENSFCAP00000001930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]