SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001941 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001941
Domain Number 1 Region: 32-220
Classification Level Classification E-value
Superfamily vWA-like 3.94e-50
Family Integrin A (or I) domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1026-1237
Classification Level Classification E-value
Superfamily vWA-like 4.96e-30
Family Integrin A (or I) domain 0.01
Further Details:      
 
Domain Number 3 Region: 600-772
Classification Level Classification E-value
Superfamily Fibronectin type III 3.73e-21
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 781-957
Classification Level Classification E-value
Superfamily Fibronectin type III 8.13e-20
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 5 Region: 235-399
Classification Level Classification E-value
Superfamily Fibronectin type III 2.42e-19
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 6 Region: 423-593
Classification Level Classification E-value
Superfamily Fibronectin type III 5.57e-18
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 7 Region: 2867-2926
Classification Level Classification E-value
Superfamily BPTI-like 4.26e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0018
Further Details:      
 
Domain Number 8 Region: 960-1045
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000222
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001941   Gene: ENSFCAG00000002099   Transcript: ENSFCAT00000002099
Sequence length 2938
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:17388735:17419621:-1 gene:ENSFCAG00000002099 transcript:ENSFCAT00000002099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPLLVAALCAGILAGALRVRAQQRERVTCTRLYAADIVFLLDGSSSIGRGNFREVRGF
LEGLVLPFSGAASAQGVRFAAVQYSDDPRTEFGLDALGSGSGGEVIRAIRELSYKGGNTR
TGAAILHVADHIFLPQLARPGVPKVCILITDGKSQDLVDTAAQRLKGQGVKLFAVGIKNA
DPEELKRVASQPTSDFFFFVNDFSILRTLLPLVSRRVCTTAGGVPVTLPTDDLTSGPRDL
VLSEAGSQSLRVRWTAASGPVTGYKVQYAPLTGLGQPLPGERREVSIPAGETSTQLQGLR
PLTEYQVTVVALYANSIGEAVSGTARTTALEGPELTIQNTTAHSLLVAWRSVPGATGYRV
TWRVLSGGVTQQQELGPGQGSVLLRDLEPGTDYEVTVSTLLGRSVGSAASLTARTDASVE
QTLRPVILGPTSILLSWNLVPEARGYRLEWRRESGLGVPQKVVLPSDVTRYQLDGLQPGT
EYRLTLYTLLEGREVATPATVVPTGPELPVGPVTDLKATELPGQRVRVSWSPVPGATEYR
ITVRSTQGVERTLVLPGSQTAFDLDDVRAGLSYTVRVSARVGSREGGASTLIVRREPETP
LAIPGLRVVASDATRVRVAWGPVPGASGFRISWRTDSGPESSQTLPPESTATDITGLRPG
TSYQVAVSALRGREEGPPVVIVARTDPLGPVRTVHVTQTSSSSVTISWNRVPGATGYRVS
WHSGHGPEKSQLVSGEATVAELDGLEPDTEYTVHVWPHVAGVDGTPASVVVRTDPAPVGS
VSKLQILNASSDVLRVTWVGVTGATAYRLAWGRSEGGPTRQQMLPGNTDSAVIRGLEGGV
SYSVRVTALVGDREGAPVSIVVTTPPEAPPALETLRVVQRGEHSLSLRWQPVPGAHGFRL
RWRPEGGQEQSRVLGPGISSYELDGLESATPYRVWLSVLGSAGEGPPTEVIARTESPRVP
STELRVVDTSIDSVTLAWTPVSGVSSYILSWQPLRRPGQDIPGASQTLPGISNSQQVTGL
EPGISYTFSLTPIREGIRGPEASVTHNPVCPHGQMDVVFLLHTTQDNAHRAEAVKRALER
LVSALGPLGPQAIQVGLLSYSHRPSPLFPLNSSYDPNIILQKIRSIPYMDPSGNNLGTAV
VTAHRHLLAPDAPGRRQHVPGVMVLLVDEPLRGDIFNPIREAQAAGLRVMILGQAGADPE
QLRRLVPGMDPVQTFFAVDDGPSLDRAVSGLATSLCQTALATQPQPEPCTLHCPKGQKGE
RGEMGLKGQAGPPGPPGLPGRAGAPGPPGPPGSTVAKGERGFPGADGPPGSPGRPGTPGT
PGSKGSPGWPGPRGDPGERGPRGPKGEPGDPGRVIGGEGPGLPGQKGDPGPPGLPGSRGP
LGDPGPRGPPGLPGTTVKGDKGDRGERGPPGPGDGGTVPGEPGLPGLPGGPGPQGPVGPS
GEKGEKGDCEDGAPGLPGQPGSPGERGPRGPPGDIGPKGDRGLKGAVGEIGEKGERGPPG
PVGPQGLPGVAGRPGAEGPEGPPGPTGRRGEKGEPGRPGDPAVGPDGAGAKGEKGDVGPT
GPRGATGVKGERGPPGLVLQGDPGPKGDPGDRGPIGLTGRAGPPGDSGPPGEKGDPGRPG
PPGLVGPRGRDGEVGEKGDEGPPGDPGLPGKAGERGLRGAPGARGPVGEKGDQGDPGEDG
RNGSPGPSGPKGDRGEPGLPGPPARLVDMGVGAGEKGEPGDRGQEGPRGPKGDPGPPGAA
GERGISGLRGPPGPQGDPGVRGPTGEKGDRGSPGLDGRSGLDGKPGAPGPPGLHGAAGKA
GDPGRDGLPGLRGEHGPPGPSGPPGAQGKPGEDGKPGLNGKNGEPGDPGEDGRKGEKGDS
GTPGREGHEGPKGERGAPGSPGLQGPPGLPGQVGPSGQGFPGVPGNTGPKGDRGESGPKG
EQGLPGERGLRGEPGSVGNVERLLETIGIKTSALREIVETWDESSGSFLPLPDRRRGPKG
DPGERGPPGKEGPIGFSGERGLKGDRGDPGPQGPPGLALGERGPPGPPGLAGEPGKPGIP
GLPGRAGDAGEAGRPGERGERGEKGERGEQGRDGPPGLPGPPGPPGPKVAVDELGPGLSG
VQGPPGLKGTKGDPGSDGDRGPKGDRGVPGIKGDRGEPGQRGLDGSPGLPGERGVAGPEG
KPGLQGPRGTPGPVGGHGDPGPPGAPGLAGSTGPQGPSGLKGEPGETGPPGRGLPGPTGA
VGLPGPPGPSGLVGPQGAPGLPGQVGETGKPGAPGRDGASGKDGDRGAPGVPGSPGLPGP
VGPKGEPGPMGAPGQAVVGPPGAKGEKGAPGGLAGDLVGEPGAKGDRGLPGPRGEKGEAG
RAGEPGDPGEDGQKGAPGLKGNKGDPGIGVQGPLGPAGPPGLKGDAGPPGPPGAPGVVGF
PGQTGLRGEMGQPGPSGERGLAGLPGREGAPGPLGPPGPPGSAGVPGPSGLKGDKGDPGA
GLPGARGERGEPGVRGEDGRPGQEGPRGLTGPPGSRGERGEKGDTGTTGLKGDKGDAAMA
VGPPGPRGAKGDMGERGPRGIDGDKGPRGDTGNPGEKGTKGEPGDKGSTGLLGARGLTGP
KGEPGAAGIPGDPGSPGKDGTPGIRGDKGDIGFMGPRGLKGERGIKGACGLDGEKGDKGE
AGPPGRPGLAGRKGDVGEPGMPGQSGTPGKEGLIGPKGDRGFDGQPGSKGDQGEKGERGS
PGIGGFPGPRGNDGSSGPPGPPGSVGPKGPEGLQGQKGERGPPGERVVGAPGAPGAPGER
GEQGRPGPAGPRGEKGEAALTEDDIRGFVRQEMSQHCACQGQFIASGSRPLPSYAADTAS
PQLHPVPVLRVSHAEEEGEVPPEDDEYEYSEYSVEEYQDPEVLQDGDDPCLLPLDEGSCT
AYTLRWYHRAVAGGTDACHPFVYGGCGGNANRFGTRGACERRCMPRVVQSQGTGAARS
Download sequence
Identical sequences ENSFCAP00000001941 XP_003982214.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]