SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001953 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001953
Domain Number 1 Region: 183-253
Classification Level Classification E-value
Superfamily Homeodomain-like 1.24e-26
Family Homeodomain 0.0000785
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001953   Gene: ENSFCAG00000002113   Transcript: ENSFCAT00000002112
Sequence length 269
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:38734707:38736239:1 gene:ENSFCAG00000002113 transcript:ENSFCAT00000002112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSS
ASSSHFGAVGESSRAFPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHSAKPSASSPSDQ
ATPASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWM
RKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKI
WFQNRRMKWKKDNKLKSMSLATAGSAFQP
Download sequence
Identical sequences A0A2I2V4A0
XP_003996795.1.62641 XP_007085790.1.5354 XP_019271426.1.44245 ENSFCAP00000001953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]