SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001990 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001990
Domain Number 1 Region: 318-576
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.21e-98
Family STAT DNA-binding domain 0.0000637
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.83e-39
Family Transcription factor STAT-4 N-domain 0.00039
Further Details:      
 
Domain Number 3 Region: 579-694
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-34
Family SH2 domain 0.00022
Further Details:      
 
Domain Number 4 Region: 136-200
Classification Level Classification E-value
Superfamily STAT 0.0000000000051
Family STAT 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001990   Gene: ENSFCAG00000002153   Transcript: ENSFCAT00000002153
Sequence length 774
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:42898091:42915618:1 gene:ENSFCAG00000002153 transcript:ENSFCAT00000002153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAHWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQGPIFPQFQTDPRAVPSQPSQNRQVSYSGFLNRLPKSNLMYQVHLWETQAIICLCKGR
LSSLQWSRQLPHVCWPPSQKLLQSASPREWTPNRISTCLLALGFSWLSRACVSKRQDLGP
CERALSGLPGTCLSVLFIFVRDTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQ
VKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRAD
RRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAF
AEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNSSSSHLEDY
NGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLI
NKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLSYLIY
VFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADSAGASATYMDQAPSPA
VCPQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDDQGIPTARR
Download sequence
Identical sequences ENSFCAP00000001990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]