SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002033 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002033
Domain Number 1 Region: 871-1176
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000543
Further Details:      
 
Domain Number 2 Region: 1133-1434
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.07e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000158
Further Details:      
 
Domain Number 3 Region: 5-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-35
Family MAM domain 0.00000592
Further Details:      
 
Domain Number 4 Region: 367-567
Classification Level Classification E-value
Superfamily Fibronectin type III 7.14e-26
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 5 Region: 266-402
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000282
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 6 Region: 170-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000351
Family I set domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002033   Gene: ENSFCAG00000002203   Transcript: ENSFCAT00000002203
Sequence length 1439
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:21187535:21248111:1 gene:ENSFCAG00000002203 transcript:ENSFCAT00000002203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPALTAGCTFEEASDPAVPCEYSQAQYDDFQWDQVQIHPGTRAPADLPHGSYLMVNASQH
APGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGIYVRVNGGPLGSAVWNMTGSH
GRQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDILLLSYPCAKAPHFSRLGDVE
VNAGQNASFQCMAAGRAAEAERFLLQRQSGALVPAASVRHISHRRFLATFLLASVSRSEQ
DLYRCVSQAPRGAGVSNFAELIVKGPPTPIAPPQLLRAGPTYLIIQLNTNSIIGDGPIVR
KEIEYRMSRGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLTRPGDGGTGRPGPPLISRTK
CAEPMRAPKGLAFAEIQARQLMLQWEPLGYNVTRCHTYTVSLCYHYTLGSSHNQTIRECV
KMERGVSRYTIKNLPPYRNVHVRLILTNPEGRKEGKEVTFQTDEDGLPCGIAAESLTFTP
LEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPRRTISKLRNETYHVFSNLH
PGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSPLGESENTITVLLRPAQGR
GAPISVYQVIVEEERPRRLRREPGSQDCFPVPLTFDAALARGLVHYFGAELAASSLPEAM
PFTVGDNQTYRGFWNPPLEPRKAYLIYFQATSHLKGETRLNCIRIARKAACKESKRPLEV
SQRSEEMGLILGICAGGLAVLILLLGAIIIIIRKGLSKQRRPEFCGVEQKGTNYVNSPNY
ETNKQKALCGETLLFLLISCEQHRSLSWCHAFNHESIMSRKQMPGTQCGDQRSGGVTEAS
SLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFEGWDA
TKKKDKVKGSRPEPVPAYDRHRVKLPPMLGGPDADYINANYIDGYHRSNHFIATQGPKPE
MVYDFWRMVWQEHCSSIVMITKLVEVGRVKCSRYWPEDSDMYGDIKITLVKTETLAEYVV
RTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGPVVIHCSA
GTGRTGCYIVLDVMLDMAECEGVVDIYNCVKALCSRRVNMIQTEEQYIFIHDAILEACLC
GETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALLPRNRDKN
RSMDVLPPDRCLPFLISTDGDPNNYINAALTDSYTRSAAFIVTLHPLQSTTPDFWRLVYD
YGCTSIVMLNQLHQSNTAWPCLQYWPEPGRQQYGLMEVEFVSGSVDEDLVARVFRVQNMS
RLQEGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAERGDGRTVVHCLNGGGRS
GTFCACATVLEMIRCHNLVDVFFAAKTLRNYKPNMVETLDQYHFCYDVALEYLEGLESR
Download sequence
Identical sequences ENSFCAP00000002033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]