SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002181 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002181
Domain Number 1 Region: 1240-1401
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-74
Family Pleckstrin-homology domain (PH domain) 0.000000043
Further Details:      
 
Domain Number 2 Region: 1036-1243
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-52
Family DBL homology domain (DH-domain) 0.00000000664
Further Details:      
 
Domain Number 3 Region: 459-581
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 843-912
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000719
Family PDZ domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002181
Domain Number - Region: 770-809
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0351
Family Ras-binding domain, RBD 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002181   Gene: ENSFCAG00000002364   Transcript: ENSFCAT00000002364
Sequence length 1591
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:13655948:13794351:1 gene:ENSFCAG00000002364 transcript:ENSFCAT00000002364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNVEHEFYGEKHASLGRKHTSRSLRLSHKARRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGALEDFGSPIWVDRVDMGLRPVSYTDSSVAPSVDSSIVLTA
ASVQSMPDSEESRLYGDDAAYLADGGRRQHPYTSNGPAFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILVSTEEKDCEEARGMEPRASPRRLSACQRANSLGDLYAQKN
SGVTANGGPRSKFAGYCRNLVSDIPELANHKMPPAAAEDSVPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPP
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGS
DAVKKSLEGIFDDTVPDGKREKEMVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQHYVPKPEEDIYELLYKEIEICP
KVTQNIQIEKSDTASDNYGFSLSSVEEDGVRRLYVNSVKETGLASKKGLKAGDEILEINS
RAAGTLNSSVLKDFLTQPSLGLLVRTYPELVGGVELLDCPPHRADGPADLNDSPLAFLSS
NPGHGLCGEQGSGAETALEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNLSDPSPS
PQDSTGPQLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSATLESYLIKPIQRILKYPLLL
KELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWPNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERIFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAISASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGAAVDTDLPEQLQAASISQRERGRKSLDSHASRMTQLKKQAALS
GINGGLEGPSEEVIWVRREDFAPSRKLNTEI
Download sequence
Identical sequences M3VYD4
XP_003991527.1.62641 XP_019695009.1.62641 XP_019695010.1.62641 XP_019695011.1.62641 XP_019695012.1.62641 XP_019695013.1.62641 ENSFCAP00000002181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]