SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002305 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002305
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-58
Family Dual specificity phosphatase-like 0.00000163
Further Details:      
 
Domain Number 2 Region: 125-333
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.62e-46
Family Dual specificity phosphatase-like 0.000000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002305   Gene: ENSFCAG00000002505   Transcript: ENSFCAT00000002505
Sequence length 625
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:84606191:84771558:1 gene:ENSFCAG00000002505 transcript:ENSFCAT00000002505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTDGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSNEGSINKILSSLD
DMSIGGNLSKTQNVERFGESNLEEDEDVEMKNSITQGDKLRALKSQRQPRSSPSCAFRLD
DTKGHPRAVPQPFRLTSSPQGSASTLKTSKVALSPSATAKRINRSSLSSGASVRSFSINS
RLASSLGNLNAATEEPENKKASSSSKAGFVASPFTNLLNGSSQPSARNYPELNNNQYSRS
NSTSGSTVSSQPSPHGAVKVEEHSPVLRPAYPGLSSSSARFLSRSIPVSSQTPPPGPQNP
ERNFCALPPQPRLPPKKFNSAKEAF
Download sequence
Identical sequences A0A2I2U1Z4
XP_003990415.1.62641 ENSFCAP00000002305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]