SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002313 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002313
Domain Number 1 Region: 99-207
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-29
Family Second domain of FERM 0.0021
Further Details:      
 
Domain Number 2 Region: 6-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.43e-16
Family First domain of FERM 0.019
Further Details:      
 
Domain Number 3 Region: 208-319
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000707
Family Third domain of FERM 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002313   Gene: ENSFCAG00000002511   Transcript: ENSFCAT00000002514
Sequence length 398
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:152426518:152435478:-1 gene:ENSFCAG00000002511 transcript:ENSFCAT00000002514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEPRDVLVQLPTREQLRLVVGVRATCRELFQRVCDVTSIKEAHFFGLSVVRDNEFMFM
DLEQKISKYFPKDWKQQVHKGGRPRAPFVSFLRVQYYVEDGRVISDKTARHLYYCHLKER
VLRSECTYREEAYFLLAAYGLQADLGNHRELVHVGRYFEPEAYFPQWIIAKRGSAYILRH
APAVHREQRGLDPKEAVLRFIREACRLEDVPVHFFRLYKDKKEDRPTIVLGLTLKGMQVY
QGKRLEIQPDGPPSARKLVYYTGCASRSGHLLRLFSATHLLRLTLRPTLPALPRCASCPH
TEKQHYRESYVSDTLDLDRDPGDKGSPGSPRSGRGGRQLPEHPSLGSADSSSSPRLRGIE
ADAGPAEPWGVSVDKPWGTEAVCGEAPPCSPSTSQRSH
Download sequence
Identical sequences ENSFCAP00000002313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]