SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002327 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002327
Domain Number 1 Region: 208-447
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.25e-70
Family Nuclear receptor ligand-binding domain 0.000000000638
Further Details:      
 
Domain Number 2 Region: 97-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002327   Gene: ENSFCAG00000002528   Transcript: ENSFCAT00000002528
Sequence length 449
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:101197086:101203011:1 gene:ENSFCAG00000002528 transcript:ENSFCAT00000002528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWLEAPVPDASPGLDSAVELWEPDAQDASGQALGVSNCVLREEASTPQSAGDSLGAGL
EATEPIVLLPGVDTPPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGC
KGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKK
LKRQEEEQAQATSMPPRVSSPPQVLPQLSPEQRGMIEKLVAAQQQCNRRSFSDRLRVTPW
PMAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVM
LLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFAL
LIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLS
SVHSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences ENSFCAP00000002327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]