SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002386 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002386
Domain Number 1 Region: 1565-1705
Classification Level Classification E-value
Superfamily SET domain 1.11e-43
Family Histone lysine methyltransferases 0.0046
Further Details:      
 
Domain Number 2 Region: 68-168
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000617
Family Canonical RBD 0.048
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002386
Domain Number - Region: 1404-1414,1446-1474
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000497
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 
Domain Number - Region: 645-657
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002386   Gene: ENSFCAG00000002588   Transcript: ENSFCAT00000002589
Sequence length 1708
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E3:19715271:19736956:-1 gene:ENSFCAG00000002588 transcript:ENSFCAT00000002589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTESRRRSSSDTAAYPAGSAGVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASAAPTTTSTAASATTAATASSSSSSSSSSSLSSSSSSSSSSSSS
HFRGTDSNYPAYYESWNRYQRHASYPPRRATREEPPGASFAENAAERFPPSYTSYLPPEP
SRPADQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPETTN
ESVPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSTTGPGSRDIGSEVPSGSGHG
PCTPPPAPANFEDVAPTGSGEPGVTRESPKANGQNQASPCSSGEDMEISDDDRGGSPPPA
PTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIY
DFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLTAASAGPPGGAFGEAFLP
FPPPQEAAYGLPYALYTQGQEGRGAYSREAYHLPLPMAAEPLPSSSVSGEEARLPPREEA
ELAEGKALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPF
QNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKR
KEPSEISEASEEKRPRPSTPAEEDEDDPEREKEAGEPGRPGTKPPKRDEERSKTQGKHRK
SFALDSEGEEASQESSSEKDEEDDEEDEDDEEREEAMDTTKKETEASDGRYRQNTXXXXX
SLYADSDGENDSTSDSESSSSSSSSSSSSSSSSSSSSSSSSESSSEEEEEEEQPATIPST
SPPPRDVPAPLPAPVEEPEPERVAGSPVTPLPEQEKSPARPVGSTEEPPPSVPQPPPEPP
AGPPAPAHRPDERPSSPIPLLPPPKKRRKTVSFSAVEEVPAPEPPPAAPPQIKSPGPISR
KVPRAVERTIRNLPLDHASLVKSWPEEVSRGGRSRAGGRGRSTEEEEAEPGTEVDLAVLA
DLALTPARRGPAALPPGDDSEATETSDEADRPGPLLSHILLEHNYALAVKPPPSTPAPRP
VEPVPAPAALFSSPADEVLEAPEVVVAEAEEPKQQQQQQQEEGEEEEEEEEESESSESSS
SSSSDGEGAVRRRSLRSHARRRRPPPPPPPPPPPSFEPRSEFEQMTILYDIWNSGLDLED
MGYLRLTYERLLQQTSGADWLNDTHWVHHTITNLSTPKRKRRPQDGPREHQTGSARSEGY
YPISKKEKDRYLDVCPVSARQLEGADTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDLLK
LNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGI
GSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEE
ITYDYKFPLEDNKIPCLCGTESCRGSLN
Download sequence
Identical sequences ENSFCAP00000002386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]