SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002538 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002538
Domain Number 1 Region: 481-755
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.04e-46
Family Extended AAA-ATPase domain 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002538
Domain Number - Region: 222-230
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0068
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002538   Gene: ENSFCAG00000002763   Transcript: ENSFCAT00000002762
Sequence length 759
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:152855255:152857534:-1 gene:ENSFCAG00000002763 transcript:ENSFCAT00000002762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPPTPQPSGLKMQWTPEHAQWPEQHFDITSTTRSPAHKVEAYRGHLQRTYQYAWANDDIS
ALTASNLLKKYAEKYSGILEGPVDRPVLSNYSDAPSGLVNGRKNESEPWQPSLNSEAVYP
MNCVPDVITASKAGVSSALPPADVSASIGSSPGVASNLTEPSYSSSTCGSHTVPSLHAGL
PSQEYAPGYNGSYLHSTYSSQPAPALPSPHPSPLHSSGLLQPPPPPPPPPALVPGYNGTS
NLSSYSYPPASYPPQTAVGSGYSPGGAPPPPSAYLPSGIPAPTPLPPTTVPGYTYQGHGL
TPIAPAALANSSASSLKRKAFYMAGQGEMDSSYGNYSYGQQRSTQSPMYRMPDNSISNSN
RGNGFDRSAETSSLAFKPTKQLMSSEQQRKFSSQSSRALTPPSYSTAKNSLGSRSSESFG
KYTSPVMSEHGDEHRQLLSHPMQGPGLRAATSSNHSVDEQLKNTDTHLIDLVTNEIIAQG
PPVDWNDIAGLDLVKAVIKEEVLWPVLRSDAFSGLTASPRSILLFGPRGTGKTLLGRCIA
SQLGATFFKIAGSGLVAKWLGEAEKIIHASFLVARCRQPSVIFVSDIDMLLSPQVSEEHS
PVNRMRTEFLMQLDTVLTSAEDQIVVICATSKPEEIDESLRRYFMKRLLIPLPDSTARHQ
IIVQLLSQHNYCLNDKEFALLVQRTEGFSGLDVAHLCQEAAVGPLHAMPATDLSAIMPSQ
LRPVTYQDFENAFCKIQPSISQKELDMYVEWNKMFGCSQ
Download sequence
Identical sequences ENSFCAP00000002538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]