SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002575 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002575
Domain Number 1 Region: 542-755
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-52
Family DBL homology domain (DH-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 234-378
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-42
Family Third domain of FERM 0.0005
Further Details:      
 
Domain Number 3 Region: 880-1032
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-32
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 4 Region: 133-233
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-29
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 5 Region: 739-864
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-29
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 6 Region: 53-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.1e-19
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002575   Gene: ENSFCAG00000002801   Transcript: ENSFCAT00000002801
Sequence length 1038
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:221054943:221145200:1 gene:ENSFCAG00000002801 transcript:ENSFCAT00000002801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTPGTRLGAQTPGGVSTLEPGQNLLATAARASARTQEKHLHLRVKLLDN
SMEIFDIEPKRDGQTLLTQVWRRLNLTECDYFGLEFQHPRAYWIWLEPMKPITRQIRRPK
NALLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLPCADTTAALLASHLLQSEIG
DYDETLDREHLKVNEYLPSQERSLEKILEFHRKHTGQTPAESDFQVLEIARKLEMYGIRF
HAASDREGAKINLAVSHMGVLVFQGTTKINTFNWSRVRKLSFKRKRFLIKLHPEVRGPYQ
DTLEFLLGSRDGCKNFWKICVEYHTFFRLFDQPQPRAKAVFFSRGSSFRYSGRTQKQLVD
YVRDSGVKRVPYERRHSKTRMSIRALTADLPRQSVSFTEGLRTSASPSSADASFYSVPTS
PLALRGLPDFRDSSGSLTEPQAPDTKRPAAERSSTAAADGNTRRAQSPGPPAPQPCQGLS
VDSPQPSPSTRKSPLSLSPASQVTLGPAEQGLFPLLSPVLSDAGGARTDGEEEPKHKSMA
ADEAYFIAKEILATERTYLKDLEVLTVWFRSAVVKEDAMPADLMTLLFSNIDPIYEFHRG
FLREVEQRLALWEGSSSAHSTGGHQRIGDILLRNMHQLKEFTSYFQRHDEVLTELEKATK
RFKKLETVYKEFELQKVCYLPLNAFLLKPIQRLVHYRLLLSRLCGHYEPGHHDYADCRDA
LQAITEVTSTLQHSLARLENLQKLTELQRDLVGIENLITPGREFIREGCLHKLTKKGLQQ
RMFFLFSDMLLYTSKGVTGTSHFRIRGLLPLRGMLVEEGESERSVPHCFTICAAQKTVVV
AASTRLEKEKWICDLNTAIDVAKSGGDPSPVLPGSVLCAPPCRSSEEVSPEQESEDTHGV
HGSLEGQGQHRANTTVHVCWYRNTSVSRADQSAAVENQLSGYLLRKFKNSNGWQKLWVVF
TNFCLFFYKTHQDDYPLASLPLLGYSVSVPKEADCVHKEHVFKLQFKSHVYFFRAESKYT
FERWMEVIERASSSPGRA
Download sequence
Identical sequences ENSFCAP00000002575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]