SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002623 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002623
Domain Number 1 Region: 121-270
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-43
Family Mannose 6-phosphate receptor domain 0.000000125
Further Details:      
 
Domain Number 2 Region: 274-421
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.92e-42
Family Mannose 6-phosphate receptor domain 0.000000374
Further Details:      
 
Domain Number 3 Region: 1474-1605
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.15e-36
Family Mannose 6-phosphate receptor domain 0.000000191
Further Details:      
 
Domain Number 4 Region: 591-719
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.49e-36
Family Mannose 6-phosphate receptor domain 0.00049
Further Details:      
 
Domain Number 5 Region: 1324-1465
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-35
Family Mannose 6-phosphate receptor domain 0.00076
Further Details:      
 
Domain Number 6 Region: 716-881
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.45e-35
Family Mannose 6-phosphate receptor domain 0.0016
Further Details:      
 
Domain Number 7 Region: 1026-1177
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.11e-32
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 8 Region: 1-118
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.84e-31
Family Mannose 6-phosphate receptor domain 0.000000987
Further Details:      
 
Domain Number 9 Region: 1181-1320
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-30
Family Mannose 6-phosphate receptor domain 0.00014
Further Details:      
 
Domain Number 10 Region: 1610-1755
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.2e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 11 Region: 2091-2238
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1945-2084
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.11e-28
Family Mannose 6-phosphate receptor domain 0.002
Further Details:      
 
Domain Number 13 Region: 891-1036
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.36e-24
Family Mannose 6-phosphate receptor domain 0.0027
Further Details:      
 
Domain Number 14 Region: 425-548
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.32e-23
Family Mannose 6-phosphate receptor domain 0.0029
Further Details:      
 
Domain Number 15 Region: 1762-1855,1904-1947
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.88e-22
Family Mannose 6-phosphate receptor domain 0.0025
Further Details:      
 
Domain Number 16 Region: 1854-1903
Classification Level Classification E-value
Superfamily Kringle-like 5.14e-17
Family Fibronectin type II module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002623   Gene: ENSFCAG00000002850   Transcript: ENSFCAT00000002850
Sequence length 2452
Comment pep:known chromosome:Felis_catus_6.2:B2:146019152:146101865:1 gene:ENSFCAG00000002850 transcript:ENSFCAT00000002850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSYTWEAVDTKNNMLYKISICGNLDIAQCGQASAVCMYDSKTSSYHSVGDSSLKTATRS
LLEFNTTETCKQNTNHKIQTSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKDIFKA
NKEVPCYVFDGEFKKHDLNPLIKISGGYLVDDSDPDTSLFINVCRDIDSLRDSSPQLRGC
PRGTAACLVRGDRAFDVGQPKEGLKLVSKDRLVLSYMKEEAGELDFCDGHSPAVTITFVC
PSERREGTIPKLTAKSNCRYEVEWVTEYACHRDYLESRTCSLSSEQHEVTVDLQPLRQDR
ASSSSYYASDGKEYMFYLNVCGEVELSFCSKKEAAVCQVKKSESSQVKVAGKYQNQTLRY
SDGDLTLIYFGGDECSSGFQRMTVINFECNKTAGNDGKGAPIFTGEVDCTYFFTWDTKYA
CIKEKEDLLCSVTEDKKRYDLSALARHSELERNWEAVDGSQRETDKKHFFINICHKVLQE
GQARGCPEDAAVCSVDKSGFKNLGKFTSSPTKEKGNIQLSYSDGDDCGHKKITTNITLVC
KPGVPAFFVSLGPLPRGEVERGCAERFRWFLGRLSLKLRAWGPTWGPCGSSLGFSFDLSP
LTKKNGAYKVETEKYDFYINVCGAVSVSFCQPDSGACQVSKSDNKAWNLGLSNAKLSYYN
GMIQLNYRDGTPYNNEKHTPRATLITFLCDRDAGVGLPEYQEEDNSTYNFRWYTSYACPE
EPLECVVTDPSTLEQYDLSSLAKSEGGRGGNWYAMDNAGERSTWRKYYINVCRPLNPVPG
CDRYASACQMKYKNDQGSFSETVSISNLGVAKTGPMVEDSGSLLLEYVNGSACTTSDGRL
TTYTTRIHLVCSRGSLNTHPIFSLSWECVVSFLWNTEAACPIQIMTDTKQACSIRDPNSG
FVFDLNPLNNTQGYVLLGIGKTFVFNVCGTMPACGTFDGKPASGCEAKTETKDLKNLKPE
RQVGLEKTLQLSTEGFITLTYKGPLYPSTGTADAFIIRFVCNDDAYPGIPKFLHQDIDSG
RGIRDTFFEFETALACVPSPVDCQVTDLAGNEYDLSGLSQVRKPWAAVDTSADGRKRTFY
LSVCTPLPYIPECHGSAVGSCLVSEDNSQNLGVVQISPQAAANGSLSIVYVNGDRCGNQR
FSTRIMFECAQTSGSPTFQLLDDCEYVFVWRTVEACPVVRVEGDNCEVKDPRHGNLYDLK
PLAVNDTVVSAGEYTYYFRVCGKLSSDVCSTDDKSKVISSCQEKRGALGFHKVAGLLTQK
LTYENGLLKMNYTGGDTCHKVYQRSTTIFFYCDRSTQRPVFLRETSDCSYVFEWRTQYAC
APFDVTECSFKDGAGNTFDLSSLARYSDNWEAVTRTGATEHYLINVCKSLSPQAGSEPCP
PEAAVCLLGSSKPVNLGRVRDGPQWKDGSTILKYVDGDLCPDQIRKKSTTIRFTCSESQV
NSRPMFISAVEDCEYTFSWPTAAACPVRSNVHDNCQVTNPATGHLFDLSSLSGKSGYTAA
YSEKGLVYISVCGENENCSPGVGACFGQTRISVGKANKRLTYVDQVLQLVYEDGSPCPSK
SGLTYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFLSWHTPLACEQVTECSVRNGSSII
DLSPLIHRTGGYEAYDESEDDTSDTGPDFYINICQPLNPMHGVPCPAGAAVCKVPVDGAP
IDIGRVTGPPILNPIANEVYLNFESSTPCLADKHFNYTSLIAFHCKRGVSMGVPMLLRTS
DCDFVFGWETPLVCPDEVRVDGCSLTDEQLHYSFNLSSLSKVPFKVTRDSRTYSVGVCTA
AAGPEQGGCKDGGVCLLSGTKGASFGRLASMRLDYRHQDEAVILSYANGDNCPPETEEGD
PCVFPFIFNGKSYDECVLEGRARLWCSTTADYDRDHEWGFCRHSNSHRTSAIIFKCDEDA
DIGRPQVFSEVRGCEVTFEWKTKVVCPPKKMECKFIQKHKTYDLRLLSSLTGSWFFVHEG
VSYYINLCQKIYKGPLDCSDRASICKKSASGVVQVLGLVHTQKLDVIGDKVIVTYSKGYQ
CGENKTASAVIELTCAKTVGRPSFKRFDLDSCTYYFSWDSRAACAVKPQEVRMVNGTITN
PRNGKSFSLGDIYFKLFSASGDMRTNGDKYLYEIQLSSITSSKNPACSGANICQVKPNDQ
HFSRKVGTSDKTKYYVQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVKDGIPEFSH
ETADCQYLFSWYTSAVCPLGVGLDGDGAGEDTQEHKGLSERSQAVGAVLSLLLVALTGCL
LTLLLYKKERRETVVSRLSSCCRRSASVSYKYSKVNKEEEADENETEWLMEEIQVPTPRP
GKEGQENGHITTKSVKAEALTSLHGDDQDSEDEVLTIPEVKVQAGRGTGAASVQHGRNAQ
RKGLRESADGAGVLVRGDRARRGRPRPAQQKPAQPGSLASFHDDSDEDLLHI
Download sequence
Identical sequences ENSFCAP00000002623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]