SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002724 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002724
Domain Number 1 Region: 821-1116
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000124
Further Details:      
 
Domain Number 2 Region: 153-297
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-34
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 45-151
Classification Level Classification E-value
Superfamily Second domain of FERM 9.16e-29
Family Second domain of FERM 0.00039
Further Details:      
 
Domain Number 4 Region: 1-44
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000141
Family First domain of FERM 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002724   Gene: ENSFCAG00000002955   Transcript: ENSFCAT00000002955
Sequence length 1120
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:133362245:133408769:-1 gene:ENSFCAG00000002955 transcript:ENSFCAT00000002955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFSLWYHNKQNQRRWVDLEKPLKKQLDKYALEPTVYFGVVFYVPSVSQLQQEITRYQYYL
QLKKDILEGNIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALFPVGWLQDEKVLE
EATQKVALLHQKYRRLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLEGIF
VKHKNGRPPVIFRWHDIAHMSHNKSFFALELASKEETIQFQTEDMETAKYVWRLCVARHK
FYRLNQCSLQTQTVTVNPIRRRSSSRVSLPKPQSYVMPPQPQLHYNGHYTEPYTSSQDNL
FATNQNGYYCHSQTSLDRAQIDLSGRIRNGSVYSAHSTNSLNNPQPYLQPSPMSSNPSIT
GSDVMRPDYVPSHRHSALIPPSYRPTPDYETVMKQLNRGMVPAERQSRSLRNLNIGNSYA
YSRPDALVYSQPEIREHAHFASPQSAHYPFSLNYSFHSPSPYPHPAERRPVAGAVSVPEL
TNVQLQAQDYPAPNIMRTQVYRPPPPYPPPRPANSTPDLSRHPYISSRSPEPPPGPARGP
CAPVLAALGPGPLHGREPGPHLGEALRPRREGLLTPSMSESDLTTSGRYRARRDSLKQRP
VSDLLSGKKNVVEGLPPLGPQVSFKERKCSSLILSIANNQQLSTYLCGAKYKRAYITSSL
AAIPRALAMCRGPSGLQQAYCSLRYNVYNILRPAARTPPSPLIVCICRLQDPAQVYAYER
LAEVSWSGSDSWWGLGVDVSPKGNATQVPEPAGQGPFILNPLSLIITYQGSGLERNVFLP
MFVGMKKSRVDAKKIGPLKLAALNGLSLSRLPLPDEGKEVPARATNDERCKILEQRLEQG
MVFTEYEKILKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINAS
HIKVSVSGIEWDYIATQGPLQNTCQDFWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRL
GSRHNTVTYGRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDL
KGFLSYLEEIQSVRRHTNSTSEPKSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVL
DIPRVLDMLRRQRMMMVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences ENSFCAP00000002724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]