SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002777 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002777
Domain Number 1 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 151-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-20
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 6 Region: 399-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000501
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002777
Domain Number - Region: 93-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00107
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002777   Gene: ENSFCAG00000003016   Transcript: ENSFCAT00000003016
Sequence length 461
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:238157:239542:-1 gene:ENSFCAG00000003016 transcript:ENSFCAT00000003016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGIPKNDLWYLSLEEVWKCEDQLDKYQENQERHLRQVAFTQKKALTQERVCENGKYGGN
CLLPAQLVLREYFHKHDSHTKSLKHNLVFSGHQESYASNSSECGQTFCQNIHLIQFARTQ
PGDKSYKCPDTVNSLTGGTSLGVSKGIHREKPYECKECGKFFSWRSNLTRHRLIHTGEKP
YECKECGKSFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYTCS
QCGKSFVHSSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGK
SYSQRSHLVVHHRTHTGLKPFECKDCGKCFSRSSHLFSHQRTHTGEKPYECHDCGKSFSQ
SSALIVHQRIHTGEKPYECCQCGKAFIRKNDLIKHQRVHVGEETYKCNQCGIIFSQNSPL
IVHQIAHTGEQFLTCNQCGTALVNSPNLIRYQTNHIRENTY
Download sequence
Identical sequences ENSFCAP00000002777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]