SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002799 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002799
Domain Number 1 Region: 11-51,182-213
Classification Level Classification E-value
Superfamily RING/U-box 3.89e-18
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 223-277
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.44e-16
Family B-box zinc-binding domain 0.00085
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002799
Domain Number - Region: 169-178
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002799   Gene: ENSFCAG00000003041   Transcript: ENSFCAT00000003041
Sequence length 295
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:90375349:90379579:-1 gene:ENSFCAG00000003041 transcript:ENSFCAT00000003041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCATTPNPMQTLQEEAVCAICLDYFKDPVSIGCGHNFCRGCVTQLWGKEDEEDRDGEE
DGWEEDEDDDVEEATGGWDNSIREVLYQGSADEVFQDQEDELWVGDGGIRNWDNMDYVWD
QEEEEEEDQDYYLGSLRHDLRIDVYPEEEISEEYEDEEELYPDTHLPPPPPPPPPPPPPP
RQFICPQCRKSFKRRSFRPNLQLANMVQIIRQMSPTPYRGSRGNDQGICSKHQEALKLFC
EVDKEAICVVCRESRTHKQHSVVPMEEVVQEYKEKKMKKFVQPCIPSAATTLRGN
Download sequence
Identical sequences A0A2I2UWM0
XP_006927552.1.62641 ENSFCAP00000002799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]