SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002968 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002968
Domain Number 1 Region: 33-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-92
Family Calponin-homology domain, CH-domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-34
Family Spectrin repeat 0.0000942
Further Details:      
 
Domain Number 3 Region: 2174-2293
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-33
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 4 Region: 605-745
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-29
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 1651-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-28
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 1014-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-28
Family Spectrin repeat 0.00000348
Further Details:      
 
Domain Number 7 Region: 1855-2009
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1536-1679
Classification Level Classification E-value
Superfamily Spectrin repeat 5.17e-25
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 9 Region: 1233-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 1.66e-24
Family Spectrin repeat 0.0007
Further Details:      
 
Domain Number 10 Region: 819-953
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-23
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 11 Region: 429-530
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 749-853
Classification Level Classification E-value
Superfamily Spectrin repeat 1.6e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 533-640
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-19
Family Spectrin repeat 0.00061
Further Details:      
 
Domain Number 14 Region: 1355-1451
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000209
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 15 Region: 2015-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002968   Gene: ENSFCAG00000003220   Transcript: ENSFCAT00000003220
Sequence length 2322
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:112439709:112506392:-1 gene:ENSFCAG00000003220 transcript:ENSFCAT00000003220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPADMTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQ
KKTFTKWVNSNLARVPCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENV
DKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTMEGRETRSAK
DALLLWCQMKTAGYPQVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEH
AFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDH
AIETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKF
QEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALREELIR
QEKLEQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEE
RVRALEDLAQELEKENYHDQKRITARKDNILRLWNYLQELLRARRQRLETTLALQKLFQD
MLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLQFTE
GKGYQPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEK
EQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDTHLEQIFQEAEGMVARKQFGHPQIEA
RIKEVSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEG
ATRALGKKHKDFLEELEESRGVMEHLEQQAQDFPQEFRDSPDVTNRLQALRELYQQVVAQ
ADLRRQRLQDALDLYTVFGETDACELWMGEKEKWLAQMEIPDTLEDLEVAQHRFDILDQE
MKTLMIQIDGVNLAANSLVDSSHPRSGEVKQYQDHLNSRWLAFQTVVSERREAVNSALRV
RNYCVDCEETSKWIEDKMHVVRSTKDLGQDLAGVIAIQRKLSGLERDVAAIQARVGALER
ESQQLMASHPEQREDIGQRQACVEQLWKDLQEALQEQEASLGEASQLQAFLQNLDDFQSW
LSMAQKAVASEDMPESLPEAEQLLQQHAAIKDEIDGHQESYQHVRVSGENVIRDQTDPEY
LLLGQRLEGLDAGWDALCRMWESRNHSLAQCLGFQEFQRDAKQAEAILSNQEYTLAHLEP
PDSLEAAEAGIRKFEDFLMSMENNQDKVLSPVDSGNKLVADKNLYSDKILEKVQLIEDRH
RKNKEKAQEASATLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEVRNLQNKWLKHQ
AFVADLASHQGWLDSIDAEGKQLMEEKPHYLALVSQRLEDLHRLWDELQATTQERTQHLS
AARNSYLRSQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELG
ELLAQVPSLGDEAEDTDVSIEKRFLDLLEPLERRKKQLESSRAKLQISRDLEDETLWVEE
RLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLQRGQRLVEVAEVDCQDIE
ERLGRLQGLWDTLREAAAGRLQRLRDASEAQQYYLDAGEAEAWISEQELYIISDETPKDE
EGAIVMLKRHLRQQHTVEEYGRNIKQLASRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLK
DMAEERRRKLENMYHLFQLKREADDLEQWITEKERMASSLEMGQDFDHVTLLRDKFRDFA
RETGAIGQERVDNVNIIIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAAS
HDLHRYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELQMLGLQVQQFQ
DVATRLQTAYAGEKADAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFLSMVRDLL
SWMEGIIRQIETQERPRDVSSVELLMKYHQGIKAEIETRSKNFSACLELGESLLQRQHQA
SEEISEKLKQVLYRRKEMNERWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASRD
FGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPEEEPGPQEEEG
ETAGEAPRGPHRAATERTSPGEEERQWPQDLQPPPPPGQEEKSSGDERPTTEPLYKVLDT
PLSEGDEPATLPAQRDHGYSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFY
KDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLS
WLQGVSTAINESQSIRVKAHGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences ENSFCAP00000002968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]