SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003018 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003018
Domain Number 1 Region: 212-552,633-657
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.66e-94
Family Myotubularin-like phosphatases 0.00000663
Further Details:      
 
Domain Number 2 Region: 33-178
Classification Level Classification E-value
Superfamily PH domain-like 7.25e-27
Family GRAM domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003018   Gene: ENSFCAG00000003271   Transcript: ENSFCAT00000003271
Sequence length 765
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:21236229:21289417:-1 gene:ENSFCAG00000003271 transcript:ENSFCAT00000003271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLKPPRPTFRSYLLPPPQTDDKINSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTSQY
DLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKVLG
PNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEYVG
KKYHNSANNINGIPSGGGSGAGGGSSQKTPLFETYSDWDREIKRTGASAWRVCSINEGYM
ISTCLPEYFVVPSSLADQDLKIFSHSFVGRRMPFWCWSHSNGSALVRMALIKDVLQQRKI
DQRICNAITKSHPQRSDVYKSDLDKTLPNIQEIQAAFVKLKHLCVDEPFEETEEKWLSSL
ENTRWLEYLRAFLKHAAELVYVLESKRLSVVLQEEEGRDLSCMVASLVQVMLDPHFRTIT
GFQSLIQKEWVMAGYQFLDRCNHLKRSEKESPLFLLFLDATWQLLEQYPAAFEFSETYLA
ILYDSTHISLFGTFLFNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVWDWSLQFTAKDR
TLFHNPLYIGKSTPCVQNGSVKAFKRTKKGYSSTLRGMPASLKNGIVTDQDLVPRRNSLI
LKGKPEPLPQPGGQARGAEQYLREWFSRPVDLHGALLPHVSGTHVKLWKLCYFRWVPEAQ
ISLGGFITAFHRLSLLADEVDVLRRTLRQHRAGPPEARCPEPDQSRMYFRVGSPQAAGTP
EFLSSSFPFSPVGNLCRRSISGTPLSKFLSGAKIWLSTETLANED
Download sequence
Identical sequences ENSFCAP00000003018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]