SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003127 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003127
Domain Number 1 Region: 305-466
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.03e-43
Family Dual specificity phosphatase-like 0.00076
Further Details:      
 
Domain Number 2 Region: 270-317
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000432
Family DEK C-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003127   Gene: ENSFCAG00000003389   Transcript: ENSFCAT00000003389
Sequence length 649
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:111612360:111620131:1 gene:ENSFCAG00000003389 transcript:ENSFCAT00000003389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVTVSRSPPASGHSTPVGPTQDQASKRRSRLQRRQSFAVLRGAVLGLQDGEDNGEAAD
AGPEAVEGPPGEEQPHSDQTDDGQGPQSPQKQQQSQHLHLMVELLRPQDDIRLAAQLEAA
RPPRLRYLLVVSTREHQSQDETVLLGVDFPDSSSPSCTLGLVLPLWSDTQVYLDGDGGFS
VTSGGQSRIFKPISIQTMWATLQVLHQACEAALGSGLVPGGSALTWAGYYQDRLSSDQSC
LNEWMAMADLESLRPPSAEPGRPSEQERMEQAIRAELWEVLDTSDLESVTSKEIRQALEL
RLGRPLQQYRDFIDNQMLLLMAQQDRASRIFPHLYLGSEWNAANLEELQRNRVSHILNVA
REIDNFYPDRFIYHNVRLWDEESAQLLPHWKETHGFVEAARAQGTRVLVHCKMGVSRSAA
TVIAYAMKQYGWSLEQALRHVQELRPIARPNPGFLRQLQTYQGILTASRQSHIWEQKVGG
ASPEEPLAPEMSTPFPPLPPEPGGSGEAKAMGLEESRSALKEEPGPRPRINLRGVMRSIS
LLEPSSELESISGASDLPEVFSSNESSEEDPPVPFPQLSKAKGGEPGPKGPWPALKSHQS
VVALNSAALVASRTRALQEQAEAGRSSTPRLRKVVRQASVDGSGEEGEA
Download sequence
Identical sequences M3W095
ENSFCAP00000003127 XP_006937624.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]