SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003220 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003220
Domain Number 1 Region: 1142-1311
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.69e-48
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0085
Further Details:      
 
Domain Number 2 Region: 995-1139
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.48e-39
Family Poly(A) polymerase, PAP, N-terminal domain 0.032
Further Details:      
 
Domain Number 3 Region: 434-493,538-636
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.92e-34
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.071
Further Details:      
 
Domain Number 4 Region: 276-465
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.03e-26
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.05
Further Details:      
 
Domain Number 5 Region: 1441-1474
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000126
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Domain Number 6 Region: 1339-1367
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000942
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 7 Region: 959-983
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000488
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000003220
Domain Number - Region: 236-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000193
Family Classic zinc finger, C2H2 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003220   Gene: ENSFCAG00000003491   Transcript: ENSFCAT00000003491
Sequence length 1495
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:26856458:26918604:-1 gene:ENSFCAG00000003491 transcript:ENSFCAT00000003491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAAKPYFVKRAKDRGTIDDEDFRRAHPQQDYLIMDDYVKGHSSKMEKGLPKKKLTPGN
YGNTPRKGPYAVSSNPYAFKNPIYSQPAWMNDNHKDQSKRWLSDELAGNSDSWREFKPGP
RIPVLNRPRKDSFQESEDGYRWQDGRGCRTVRRLFHKDLTSLETMSEMEAGSPENKKQRS
RPRKPRRSRNEENEQDGDLEGPVIDESVLSMKELLGLQQAEERLKRDFIDRLKRRPGNYP
TAKYTCKLCDVLIESIAFAHKHIKEKRHKKNIKEKQEEELLTTLPPPTPSQINAIGIAID
KVVQEFGLHNENLEQRLEIKRIMENVFQHKLPDCSLRLYGSSCSRLGFRNSDVNIDIQFP
AIMSQPDVLLLVQECLKNSESFVDVDADFHARVPVVVCREKQSSGLLCKVSAGNENACLT
TNHLTALGKLESKLVPLVIAFRYWAKLCSIDHPEEGGLPPYVFALMAIFFLQQRKEPLLP
VYLGSWIEGFSLNKLGNFNLKDVQEDTVVWEYADNAAGDAETAEHEAPREVPVKRGQVSL
IFDFKHQPSVPVGQLWVEMLRFYALEFNLADLVISIRVKESVSRESKDWPKKRIAIEVTD
PYSVKRNVARTLNNQPVFEYILHCLRTTYKYFALPHKITKSSLPKPLNTVTRISEHPKEV
ANVGARAKGDELKSSALAQEPGAASSGANTCQVQPLTETAESFGGPPTEEMGHAHVSIHL
ENSSRIRTGAGCDGCEDVKAHRQAAGSKAGSEGKHPLPAGDQGPSSSRRGELVLRGGTQN
KETHNTLDVEDFHSPTADECDGFVTSEDKADVDEEGVEGPDELEDALGHFAPSRQGHVSR
IIHSEEEEEEEEEEEEDDEEPRLSIPRREDEDDLANEDELENPYTGSGDEDALSEEDDEL
GGSAKYKDLKEDGKHVDGALLMELNKISLKEENACEESCTADQSDFFYEFSKLIFTKGKS
PTVVCSLCKREGHLKKDCPEDFKRIQLEPLPPLTPKFSNILDQVCIQCYKDFSPTILEDQ
AREHIRQNLESFIRQEFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGLETAEGLDCVRTI
EELARVLKKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAI
DPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQEIYKGEK
KPEIFVDGWNIYFFDQIDELPTYWPEYGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRR
KSLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAFINGRRVFGIPVKGFPK
DYPSKMEYFFDPEVLTEGELAPNDRCCRICGKIGHFMKDCPMRRKVRRRRDQEDTLNQRY
PENKEKRSKEDKDIQNKHTERDVLTKEEKPVQCTPQKAKPVRTAVDLGREKILRPPVEKW
KRQDDKDLREKRCFICGREGHIKKECPQFKGSAGSLSSKYMTQGKASAKRTQQES
Download sequence
Identical sequences ENSFCAP00000003220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]