SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003246 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003246
Domain Number 1 Region: 300-512
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.47e-59
Family Eukaryotic proteases 0.00000000987
Further Details:      
 
Domain Number 2 Region: 106-212
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-32
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 3 Region: 215-303
Classification Level Classification E-value
Superfamily Kringle-like 1.55e-30
Family Kringle modules 0.0000267
Further Details:      
 
Domain Number 4 Region: 37-86
Classification Level Classification E-value
Superfamily FnI-like domain 7.53e-18
Family Fibronectin type I module 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003246   Gene: ENSFCAG00000003517   Transcript: ENSFCAT00000003518
Sequence length 512
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:41833262:41846681:1 gene:ENSFCAG00000003517 transcript:ENSFCAT00000003518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMNNLRKELVFTLLFCGAALTLPSQEIHPRFRRGARSYRVTCRDEKTQMLYLQNESWLRP
VLRSNRLEYCWCNSGRSLCHSVPVRSCSEPRCFNGGTCRQALYFSDFVCECPEGFSGKRC
EIDASATCYKDQGITYRGTWSTAESGAECINWNSSVLALKPYNGRRPNAIMLGLGNHNYC
RNPDRDSRPWCYVFKAGQYSTEFCSTPACPKEKNGDCYFGKGLAYRGTYSLTTSGASCLQ
WSSRALIGKVYTAWKNNAQALGLGKHNYCRNPDGDAKPWCHVLKDHKLTWEYCDVPQCST
CGLRQYKQPQFRIKGGLYADITSHPWQAAIFVKNRRSPGERFLCGGILISSCWVLTAAHC
LQERYPPHHLKVVLGRTYRVVPGEEEQKFEVEKYIIHKEFDDDTYDNDIALLKLQSDSLQ
CAQESDTVRTVCLPEADLRLPDWTECELSGYGKHEASSPFYSERLKEAHVRLYPAGRCTS
QHLFNRTVTNNMLCAGDTRSGGNQANLHDACQ
Download sequence
Identical sequences ENSFCAP00000003246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]