SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003265 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003265
Domain Number 1 Region: 216-230,356-617
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-63
Family Nuclear receptor ligand-binding domain 0.0000672
Further Details:      
 
Domain Number 2 Region: 147-229
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.66e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003265   Gene: ENSFCAG00000003537   Transcript: ENSFCAT00000003538
Sequence length 629
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:53754739:53848576:-1 gene:ENSFCAG00000003537 transcript:ENSFCAT00000003538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNMEGLVQHRVGTQQVAEVPRTQTSRPESPGMTSPSPRIQIISTDSAVASPQRIQIVT
DQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVP
GRIQIVTDSACVERLLGKADVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRK
NLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAAS
TEKIYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKA
ETSQGALGTLANVVTSLANLSESLNNGDTSEMQPEDQSASEITRAFDTLAKALNTTDSSS
PPSLADGIDASGGGGIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYIC
ESASRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQVMSLSTILAAI
VNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPG
LTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEELFFTGLI
GNVSIDSIIPYILKMETAEYNGQITGASL
Download sequence
Identical sequences M3W0I7
ENSFCAP00000003265 XP_003982568.2.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]