SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003337 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003337
Domain Number 1 Region: 614-680
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 5.23e-27
Family VHP, Villin headpiece domain 0.00002
Further Details:      
 
Domain Number 2 Region: 104-142
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.57e-16
Family LIM domain 0.0019
Further Details:      
 
Domain Number 3 Region: 175-237
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.95e-16
Family LIM domain 0.0018
Further Details:      
 
Domain Number 4 Region: 47-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000408
Family LIM domain 0.0023
Further Details:      
 
Domain Number 5 Region: 234-267
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000855
Family LIM domain 0.0021
Further Details:      
 
Domain Number 6 Region: 142-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000565
Family LIM domain 0.0011
Further Details:      
 
Domain Number 7 Region: 17-45
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000074
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003337   Gene: ENSFCAG00000003622   Transcript: ENSFCAT00000003622
Sequence length 680
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:197400662:197469914:-1 gene:ENSFCAG00000003622 transcript:ENSFCAT00000003622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STVPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFF
FKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVT
FSGKECVCQTCSQSMTSSRPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCS
VILTGEYISKDGVPYCESDYHSQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQM
FTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICAKVDNE
ILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYTSDEMLERCGYGESLGTLSPYSQDIYE
SLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSSTP
TSYQAPKHFHIPAGESNIYRKPPIYKRHGDLSTATKSKTSEDISQASKYSPAYSPDPYYA
AESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPW
TPPRSSTSSREALHTAGYDMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADL
FHYDSMNAVNWGMRAPIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFGMTIS
EFDRLALWKRNELKKQARLF
Download sequence
Identical sequences ENSFCAP00000003337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]