SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003371 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003371
Domain Number 1 Region: 28-224
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-57
Family Prokaryotic proteases 0.00000064
Further Details:      
 
Domain Number 2 Region: 239-335
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-23
Family HtrA-like serine proteases 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003371   Gene: ENSFCAG00000003656   Transcript: ENSFCAT00000003657
Sequence length 338
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:80344512:80370242:1 gene:ENSFCAG00000003656 transcript:ENSFCAT00000003657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRPYLGLVMDGFAGQWQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVA
SGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHEGKL
PVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAI
INYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKY
IGIRMMSLTSSKAKELKDRHRDFPDVLSGAYIIEVIPDTPAEAGGLKENDVIISINGQSV
VSANDVSDVIKKESTLNMVVRRGNEDIMITVIPEEIDP
Download sequence
Identical sequences ENSFCAP00000003371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]