SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003459 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003459
Domain Number 1 Region: 130-216
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.74e-36
Family SCAN domain 0.0000134
Further Details:      
 
Domain Number 2 Region: 498-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000455
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 321-350
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000798
Family KRAB domain (Kruppel-associated box) 0.0031
Further Details:      
 
Domain Number 4 Region: 432-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000645
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003459   Gene: ENSFCAG00000003753   Transcript: ENSFCAT00000003754
Sequence length 555
Comment pep:known_by_projection scaffold:Felis_catus_6.2:JH408942.1:7668:12726:-1 gene:ENSFCAG00000003753 transcript:ENSFCAT00000003754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRILTYPPSRLLVSLGLGCKGRVVASDGREPPNSAILQIPLRGTALNSERPLEMSIRWR
RPRPSLLAGSHGKRSPKGAGGKIDSGGSGLGVAGLTGRPGYKKTPSTTMPSPLGPPRLPS
VDPVATLEEPEAARLRFRGFCYQEVAGPREALARLRELCRQWLRPEACSKEQMLELLVLE
QFLGTLPPEIQAWVRGQRPGSPEEAVALVEGLQNNPGQLLGWITAHVLKQVVLPAAQKIE
ESLGRPQPSGTVELLRATSGEEPQDTQMEGSPQLSCSVKEEPDADGQEMAPSSPPHPSQS
REGYPGHREPAATSFHPPRIQEEWGLLDRSQKELYWDAMLEKYGTVVSLAGLPAPLPEAR
VESEPGVLRSGTEGQRSLHPGDESESHCEGPPRCPEAQPPQGPRPVTWEGPSGASVSTRA
TPGAGLEAGAPRRKPYTCELCGRGFDWKSVFVIHHRTHADGQATRAPVLAVGGAQKLPPG
SREPGTPRHPRRALPGPRSYACEECGRSFSWKSQLVIHRKSHAGQRRHFCGDCGRSFDWK
SQLVIHRKSHRPEAP
Download sequence
Identical sequences ENSFCAP00000003459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]