SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003473 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003473
Domain Number 1 Region: 10-58
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.0000000000314
Family Supernatant protein factor (SPF), C-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000003473
Domain Number - Region: 66-126
Classification Level Classification E-value
Superfamily MTH1598-like 0.034
Family MTH1598-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003473   Gene: ENSFCAG00000003769   Transcript: ENSFCAT00000003770
Sequence length 143
Comment pep:novel chromosome:Felis_catus_6.2:D3:6286482:6292829:-1 gene:ENSFCAG00000003769 transcript:ENSFCAT00000003770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKG
QDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEAL
VLVAMTLGQIYYLKRFFEVRRVV
Download sequence
Identical sequences G1SJR4 G7N699
ENSOCUP00000002994 ENSFCAP00000003473 ENSOCUP00000002994 9986.ENSOCUP00000002994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]