SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003479 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003479
Domain Number 1 Region: 1057-1195,1252-1540
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.94e-108
Family Myotubularin-like phosphatases 0.00000568
Further Details:      
 
Domain Number 2 Region: 1595-1798
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-30
Family Pleckstrin-homology domain (PH domain) 0.0000235
Further Details:      
 
Domain Number 3 Region: 828-970
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-17
Family GRAM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003479   Gene: ENSFCAG00000003775   Transcript: ENSFCAT00000003776
Sequence length 1801
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:68449598:68723029:-1 gene:ENSFCAG00000003775 transcript:ENSFCAT00000003776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCQPGGWQLSRERKQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEEIEGEVEGS
GLIQPAEVFAPKSLVLVSRLDYPEIFRACLGLIYTVYVDSLNVSLESLIANLCACLVPAA
GGSQKLFSLGAGDRQLIQTPLHDSLPVTGTSVALLFQQLGIQNVLSLFCAVLTENKVLFH
SASFQRLSDACRALESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSIFKTDIHEL
LDVIIADLDGGTIKIPECIHLSSLPEPLLHQTQAALSLILHPDLEVADHAFPPPRTALSH
SKMLDKEVRAVFLRLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLVENDFLTKV
LNGMAFAGFVSERGPPYRSCDLFDELVAFEVERIKVEENNPVKIIKHVRELAEQLFKNEN
PNPHMAFQKVPRPTEGSHLRVHILPFPKINETRVQELIQENLAKNQNAPPASRVEKKCVV
PAGPPVVSIMDKVTTVFNSAQRLEVVRNCISFIFENKTLETEKTLPAALRALKGKAARQC
LTDELGLHVQQNRAILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAP
GVSQFAYTCVQDHPIWTNQQFWETTFYSAVQEQVRSLYLSAKEDNHAPYLKQKDKLPDDQ
YQEKTAMDLAAEQLRLWPSLSKSTQQELVQREESTVFSQAIHFANLMVNLLVPLDTSKNK
LLRTSAPGDWESGSNSIVTNSIAGSVAESYDTESGFEDSENNDIANSVVRFITRFIDKVC
TESGVTQDHIKSLHCMIPGIVAMHIETLEAVHRESRRLPPIQKPKILRPALLPGEEIVCE
GLRVLLDPDGREEATGGLLGGPQLLPAEGALFLTTYRILFRGTPHDQLVGEQTVVRSFPI
ASITKEKKITMQNQLQQNMQEGLQITSASFQLIKVAFDEEVSPEVVEIFKKQLMKFRYPQ
SIFTTFAFAAGQTTPQIILPKQKEKNTSFRIFSKTIVKGAKRAGKMTIGRQYLLKRRTGT
IVEERVNRPGWNEEDDVSVSDDSELPTNTTLKASEKSTMEQLVEKACFRDYQRLGLGTIS
GSSSRPKPEYFRITASNRMYSLCRSYPGLLVVPQAVQDSSLPRVARCYRHNRLPVVCWKN
SKSSTLLLRSGGFHGKGVVGLFKSQNSPQAAPTSSLESSSSIEQEYLQALLNAVSVQQKL
SGNNTLTVRPALALSPGVWASLRSSTRLISSPTSFIDVGARLAGRDHSASFSNSTYLQNQ
LLKRQTALYIFGEKSQLRNFKLEFALNCEFVPVEFHDIRQVKASFKKLMRACVPSTIPTD
SEVTFLKALGDSEWFPQLHRIMQLAVVISEVLENGSSVLVCLEEGWDITAQVTSLVQLLS
DPFYRTLEGFRMLVEKEWLSFGHKFSQRSSLTLNCQGSGFTPIFLQFLDCVHQVHNQYPT
EFEFNLYYLKFLAFHYVSNRFKTFLLDSDYERLEHGTLFDDKGDKHAKKGICIWECIDRM
HKRSPIFFNYLYSPMEIEALKPSVNVSSLKKWDYYTEETLSTGPSYDWMMLTPKHFPSED
SEVAGGAGPQSRRRTVWPCYDDISCAQPDALTSLFSEIERLEHKLNQTSEKWQQLWERVT
VDLKEEPRTDRPQRHPSGSPGIVSTNLPSYQKRSLLHLPDSSTGEEQSASISPSNGVDRR
AATLYSQYTTKNDENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGH
IDLAEVEMVIPAGPSMGAPKHTSDKAFFDLKTSKRVYNFCAQDGQSAQQWMDRIQSCISD
A
Download sequence
Identical sequences ENSFCAP00000003479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]