SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003508 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003508
Domain Number 1 Region: 27-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000418
Family KRAB domain (Kruppel-associated box) 0.0057
Further Details:      
 
Domain Number 2 Region: 243-364
Classification Level Classification E-value
Superfamily SET domain 0.00000000801
Family Viral histone H3 Lysine 27 Methyltransferase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003508   Gene: ENSFCAG00000003804   Transcript: ENSFCAT00000003805
Sequence length 496
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:63863337:63877649:-1 gene:ENSFCAG00000003804 transcript:ENSFCAT00000003805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSPLRFPEQSAERGSRKARWKPTAKDAFKDISIYFSKEEWTEMGDWEKIRYRNVKRNYEA
LMTIGLRAPRPAFMCHRRQAIKPQVDVTEDSDEEWTPRQQVKPSWVASRVDQNKQHKGTH
RVPLSKESSLKDFSETAKLLNTSGSEQGQKPVSLPGEASTSGHHSRRKLELRRKEIGVKM
YSLRERKGFAYQEVSEPQDDDYLYCEKCQNFFIDSCAVHGPPTFVKDNAVGKGHPNRSAL
TLPPGLRIRPSSIPEAGLGVWNEASDLPLGTHFGPYEGQITEDEEAANSGYSWLITKGRN
CYEYVDGKDNSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWYGDE
YGQELGIKWGSKWKSELSTGKGGHQCSSKQKEKKEFSLAVSMSSSRVKSCLKSQNHSQTS
IDVPPARWPSPVRNSSANMWNANTLLRASHKYLQENISNQRIPAQVIRISSSSNILIHTA
GMTKQNVKRSKKGPDL
Download sequence
Identical sequences ENSFCAP00000003508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]