SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003640 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003640
Domain Number 1 Region: 3-292
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003640   Gene: ENSFCAG00000003944   Transcript: ENSFCAT00000003946
Sequence length 425
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:11204643:11270805:-1 gene:ENSFCAG00000003944 transcript:ENSFCAT00000003946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKEFEQIDKAGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQE
DNDYINASLIKMDEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCA
QYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTSQETREILHFHYTTWPDF
GVPESPASFLNFLFKVRESGSLSTEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPS
SVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQEQWKELSHEDLEPP
PEHVPPPPRPPKRILEPHNGKCKEFFPNHQWVKDETGEDKEDCPIKEETKTPLNVPCSVE
STSPDTEVRRRVMGAGPAQGEPSPPKEEQDQALTPWKPFLVNMCMATVLTAGAYLCYRFL
FSSST
Download sequence
Identical sequences ENSFCAP00000003640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]