SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003669 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003669
Domain Number 1 Region: 647-930
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.27e-78
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000003669
Domain Number - Region: 309-411
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0101
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003669   Gene: ENSFCAG00000003977   Transcript: ENSFCAT00000003978
Sequence length 944
Comment pep:novel chromosome:Felis_catus_6.2:C1:193518609:193552236:1 gene:ENSFCAG00000003977 transcript:ENSFCAT00000003978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKKQLLRDLSGLQGMNGSVQAKAIQVLPSHELVSTRIAEHLGDSQSLGRMLADYRARGGR
IQQKNADPFAHSKDVPGTSSGRSGSKTDGDEEKGLIPSDAVWSTKVDCLNPVNHQRLCVL
FSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLERYCFSQRPSYQCPSMFCDTPMV
HHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICKQVTPVVALSNESWSMSFAK
YLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASFSYSPIRLLEVCVPLPKIFI
KRQAPLKVSLLQDLKDFFQKVSQVYLAVDERLASLKTDTFSKTREEKMEDIFAQKEMEEG
EFKNWVEKMQARLMSSSADAPQQLQSIFESLIAKKQSLCEVLQAWNNRLQDLFQQEKGRK
RPSVPPSPGRLRQGEESKISAMDAAPRNISPGLQNGEKEDRFLTTLSSQSPASSAHLQLP
TPPEALPEQLAGAPPELDTASSSEDVFDGHLLGSTDSQVKEKSTMKAIFANLLPGNSYNP
IPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEYRNALEELSKATQRNSAEEG
LPTNSTLDSRPKSSSPIRLPEVSGGQTNRTAEAEPQPNEVDGGDTQKKQLINPHVELQFS
DANAKFYCRLYYAGEFHKMREVILGSSEEDFIRSLSHSSPWQARGGKSGAAFYATEDDRF
ILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDL
LVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHS
KAVLRASIRSDSHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRTFTWDKKLEMVVKST
GILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC
Download sequence
Identical sequences ENSFCAP00000003669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]