SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003731 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003731
Domain Number 1 Region: 112-206
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-22
Family PDZ domain 0.0000727
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000003731
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0122
Family PDZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003731   Gene: ENSFCAG00000004041   Transcript: ENSFCAT00000004042
Sequence length 740
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:124594717:124600498:-1 gene:ENSFCAG00000004041 transcript:ENSFCAT00000004042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVNGKELSKLSQEQTLEALRSSKEPLVIQVLRRSPRLRGDSSCHDLQLVDSGTQTDITFE
HIMALGKLRPPTPPMVILEPYVLSELPPISHEYYDPAEFMEGGPQEADRMDELEYEEVEL
YKTSHRDKLGLMVCYRTDDEEDLGIYVGEVNPNSIAAKDGRIREGDRIIQINGVDVQNRE
EAVAILSQEENTNISLLVARPESQLAKRWKDSDRDDFLDDFGSEHEGELRARKLKPPAAQ
QVRKEARAGLSNSQELDSGVGRTDESTRTEESSEHDLLGDEPASAADTPGALRKSRDLHF
SMDSLLAEGAALGGGDLPGLTEEEYERYRELLEIKGHLENGNQLGLLFPRASGGGNSALD
VNRNESLGHEMAMLEEELRHLEFKCRNILRAQKMQQLRERCMKAWLLEEEGLYDLGAGEP
KKHELSDISELPEKSDKDSTSAYNTGESCRSTPLLAEPLPESPLRRAAAGNSNLNRTPPG
PAGPTHPKAAPPQGSPAKFRSLSRDPELGRRPHSEERVRRSPKPGVTLERVGPEGSPYLS
RRHRGQGQESEHYHSCVQLAPPRGLEELGHGPLTLAGGPRVGGAAAATEAPRMEWKVKVR
SDGTRYVAKRPVRDRLLKARALKIREERSGMTTDDDAVSEMKMGRYWSKEERKQHLIRAR
EQRKRREFMMQSRLECLREQQNGDSKAELNIIALSHRKTMKKRNKKILDNWITIQEMLAH
GTRSADGKRVYNPLLSVTTV
Download sequence
Identical sequences ENSFCAP00000003731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]