SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003780 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003780
Domain Number 1 Region: 17-163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.09e-37
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003780   Gene: ENSFCAG00000004098   Transcript: ENSFCAT00000004099
Sequence length 188
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:21820740:21821306:-1 gene:ENSFCAG00000004098 transcript:ENSFCAT00000004099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPPCTFPVQFRQPSVSGLSQITSSLYISNGVAANNKLMLSSNRITTVINVSVEVVNTL
YEDIQYVQVPVADTPISRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFQLFGKNSVHMVSSPMGVIPDIYEK
EVHLMIPL
Download sequence
Identical sequences XP_007082620.1.5354 XP_014936993.1.86478 XP_014936994.1.86478 ENSFCAP00000003780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]