SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003813 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003813
Domain Number 1 Region: 373-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000121
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 817-868
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000746
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 1016-1066
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000136
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 333-341
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000162
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000003813
Domain Number - Region: 433-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00717
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003813   Gene: ENSFCAG00000004139   Transcript: ENSFCAT00000004140
Sequence length 1082
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:82104967:82241886:1 gene:ENSFCAG00000004139 transcript:ENSFCAT00000004140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPRLSDSAPDILPTDVSRLEEAEGELSEGEHWYGNSSETPSEASYGEVQENYKLSLEDRI
QEQSTSPDTSLGSATPSSHTLELVGLDGEVLRDSLQCQDHLSPGVSSLCEDDPPGSTKPL
SSNLRRLLEAGSLKLDATATANGRVESPVNVGSNLSFSPPSHHAQQLSVLARKLAEKQEQ
NDQYAPSNRFIWNQGKWLSNSTTTCGLSPDSAILKLKAAANAVLQDKSLTRTEETMRFES
FSSPFSSQSASSTLAALSKKVSERSLTPGQEHPPPASSFLSLASMTSSAALLKEVAARAA
GSLLAEKSSLVPEDPLPPPPSEKKQEKVTPPPPPPPPPPPPPPPQSLELLLLPVPKGRVS
KPSSSASEEESGKPFQCPICGLVIKRKSYWKRHMVIHTGLKSHQCPLCPFRCARKDNLKS
HMKVHQHQDRGETFQCQLCPFTSSRHFSLKLHMRCHQHFLRTEAKVKEEIPDPDVKGSPH
LSDSACLGQQREGGGTELVGTMMTSNTPERTSQGGAGVSPLLVKEEPKEDNGLPTSFTLN
AADRPANHTKLKDPSEYVANSASALFSQDISVKMASDFLMKLSAANQKEPMNLNFKVKEE
PKEEEALNAALPRSSYVFSPESEVSAPSIAEDTLKPQEGKGNVLRPDMSVKAASELLMKL
SAESYKETQMVKIKEEPMEVDIQDSHVSVSPSRNVGYSTLIGREKTEPLQKMPEGRVPPE
RNLFSQDISVKMASELLFQLSEKVSKENNHTKENTIRTTTSPFFSEDTFRQSPFTSNSKD
LLPSDSVLHGRISAPETEKIVLEAGNGLPSWKFNDQLFPCDVCGKVFGRQQTLSRHLSLH
TEERKYKCHLCPYAAKCRANLNQHLTVHSVKLVSTDTEDIVSAVTSEGSDGKKHPYYYSC
HVCGFETELNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKAHIGTKHTGEDRKT
PSESNSPSSSSLSALSDSANSKDDSDSSQKNKSGNNVLVISVVPGSQPSLNSEEKPEKGF
ECVFCNFVCKTKNMFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTGGLNSG
QW
Download sequence
Identical sequences ENSFCAP00000003813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]