SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003907 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003907
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-26
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 184-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-25
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003907   Gene: ENSFCAG00000004240   Transcript: ENSFCAT00000004241
Sequence length 426
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:20491068:20539870:1 gene:ENSFCAG00000004240 transcript:ENSFCAT00000004241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGD
VSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGASKTSNKLTIQTCISF
CRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTL
VGACGGNYSAMTAVVYSPDFPDTYATGRVCYWTIRVPGASHIHFNFTLFDIRDSADMVEL
LDGYTHRVLVRFNGRNRPPLSFNVSLDFIILYFFSDRINQAQGFAVLYQAVKEELPQERP
TANQTLAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGWTVYGLATLLILTVTAI
VAKILLHVTFKSHRVPASGDLRDCRQPGTSGEIWTIFYEPSTSISIFKKKLKSQSQQDDR
NPLVSD
Download sequence
Identical sequences ENSFCAP00000003907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]