SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003916 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003916
Domain Number 1 Region: 178-319
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 70-177
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-38
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 466-559
Classification Level Classification E-value
Superfamily Moesin tail domain 2.09e-25
Family Moesin tail domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.89e-20
Family First domain of FERM 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003916   Gene: ENSFCAG00000004249   Transcript: ENSFCAT00000004250
Sequence length 559
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:20905526:20958194:1 gene:ENSFCAG00000004249 transcript:ENSFCAT00000004250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFL
AKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSV
HKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMY
GVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLD
KKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQ
RLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKL
LAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQD
LQEAREAERRAKQKLLEITTKPTYPPMNPIPAPLPPDMPSFNLIGDSLSFDFKDTDMKRL
SMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGTSSKHNT
IKKLTLQSAKSRVAFFEEL
Download sequence
Identical sequences ENSFCAP00000003916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]