SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003998 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003998
Domain Number 1 Region: 159-543
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-155
Family Myotubularin-like phosphatases 0.0000000000427
Further Details:      
 
Domain Number 2 Region: 35-155
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-41
Family GRAM domain 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003998   Gene: ENSFCAG00000004332   Transcript: ENSFCAT00000004333
Sequence length 603
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:121893254:121967078:1 gene:ENSFCAG00000004332 transcript:ENSFCAT00000004333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAPTSKYNSHSLENESVKRTSRDGVNRDLSETVPRLPGETRITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDMRNLR
FALKQEGHSRRDMFDILTRYAFPLAHSLPIFAFLNEEKFNVDGWTVYNPVEEYRRQGLPN
HHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIV
RCSQPLVGMSGKRNKDDEKYLDVIRETNRQISKLTIYDARPNVNAVANKATGGGYESDDA
YHNAELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSDLSLTLFLELVKLVLTGAIQV
ADKVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFAS
RIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNERFLITILDHLYSCRFGTFLY
NCESARERQKVTERTVSLWSLINSNKDKFKNPFYTKEINRVLYPVASMRHLELWVNYYIR
WNPRIKQQQPNPVEQRYVELLALRDEYIQRLEELQLAGSAKLAEPSTSPAGPSPMMPHVH
THF
Download sequence
Identical sequences ENSFCAP00000003998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]