SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004022 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004022
Domain Number 1 Region: 665-749
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000163
Family Canonical RBD 0.0043
Further Details:      
 
Domain Number 2 Region: 995-1077
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000236
Family Canonical RBD 0.0047
Further Details:      
 
Domain Number 3 Region: 1913-1967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000357
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 4 Region: 891-974
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000309
Family Canonical RBD 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000004022
Domain Number - Region: 423-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00167
Family Classic zinc finger, C2H2 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004022   Gene: ENSFCAG00000004356   Transcript: ENSFCAT00000004357
Sequence length 1982
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:90279629:90348482:1 gene:ENSFCAG00000004356 transcript:ENSFCAT00000004357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPRFNPRGNFPLQRPRAPNPSGMRPPGPFMRPGSMGLPRFYPAGRARGIPHRFAGHES
YQNMGPQRMNVQVTQHRTDPRLTKEKLDFHEAQQKKGKPHGSRWDDEPHISASVGVKQSS
ITQVTEQSPQVQSRYTKESASSILASFGLSNEDLEELSRYPDEQLTPENMPLILRDIRMR
KMGRRLPNLPSQSRSKETLGNEAVSSNVIDYGHASKYGYTEDPLEVRIYDPEIPTDEVKN
EFRSQQSISASVPTPNVICNSMFPVEDVFRQMDFPSESSNNQSFFPVESGTKMSGLHISG
QSVLEPVKSVSQSISQTVNQSMNQSLIPPSMSQQPFSSELISAVSQQERIPHEPVINSSN
VHGSGGSKKNYQSEADIPIQSPFGIVKASWLPKFSHADAQKMKRLPTPSMMNDYYAASPR
IFPHLCSLCNVECSHLKDWIQHQNTSTHIESCRQLRQQYPDWNPEILPSRRNEGNRKENE
TPRRRSHSPSPRHSRRSSSSHRFRRSRSPIRYIYRPRSRSPRICHRFISRYRSRSRSPYR
MRNPFRGSPKCYRSVSPERTSRRSVKSSDRKKALEDVVQRSGHGSEFSKQKHLEAVDKGH
SPAQKPKTGSGSKPSVKSTNSTKSDSNLGGHSTRYKVKNIEDDTLPECKQVSDKAVSLQR
KLRKDQSSHYGSVLLISELPEDGCTEEEIRKMFQPFGKVNDVLIVPYRKEAYLEMEFKEA
VTAVMKYIETTPLLIKGKNVKICVPGKKNHRNKEVKKKASDSKKTAASTLKKDLDASKAV
DTVTSGAAGKLLLILLQMSIFFCYLGKSAGSVKSVVTVAAKGNKASVKTAKSSGKKSLEV
KKAGIVKNKDTNKPVIVPENSEIKTSVEVKATENSAKETVSEAAVEATENEQVNKETEEM
CVVLISNLPNKGYSIEEVYNLVKPFGGLKDILILSSHKKVFMEVNRKCADSMVKFYTCFP
ISMDGNQLSISMVPENMNIKDEEAIFTTLIKENDPEANVDKIYNRFVHLDNLPEDGLQCV
LCVGLQFGKVDHHVFMSNKNKAILQLDSPESAQSMYSFLKQNPQNIGDHVLTCTLSPKMD
SSEVRLFCINFLNTFSPDLKNSPVDESEVQTAADSPSVKPSEVEEETVPNIETETSVQLE
EPCVEEPEKALCDSDFAIETLEVETQGEEVKVEIPLVASTPISIELFTENVEECVLNQQV
YTSDFEKEEAEIINPETELSTSDSAFIEERNIKGILEESPAEAEDFFSGITQSMIEAVAE
VDKHETVSEIVPSPCVVALVPGIAIGDEKAVNKKGIPEKSNMDEKEKNEINSKETRMDLQ
IGTEKAERNDARMVAEKLEKVMAAVKEKPAENAVIKAYPNKGMGQANKPDETSKTSMLAV
SNTSSTKSSIKAGMVSSPKAKATASKSENQKSFLKSVLRDQINAEKKLSAKELGLLKPPS
ARSGLAENSNKFRPTHCGVTRGGSGRISALQGKDSKLDYRDITKQSQETEARPSIMKRDD
SNNKTLAGQNTKNPKGTTGRSSKSKEXXSFPFNLDEFVTVDEVIEEVNPFQAKQNPLKGK
RKEALKNTPSSELNLKKKKGKTSAPRVVEGELSFVTLDEIGEEEDGAAHLAQALVTVDEV
IDEEEINMEEMVKNSNSLLTLDELIDQDDCISHSEPKDVTVLSVAEEQDLLKQERLVTVD
EIGEVEELPLNESADLSFTTLNTKGDEGNTGRDPIGFISSQMPEDPSTLVTVDEIQDDSS
DLHLVTLDEVTEEDEDSLADFNNLKEELNFVTVDEVGEEEDGDNDLKVELAQSKNDHPTD
KRGDRKKRAVDTKKMKLEALSHIGPINENVMEEDLKTMIERHLAAKTPTKRVRIGKTPPS
ERAVATEPVKGEEAFQISEVDEESALKDSEPERKRKKIEDSLGKSVVPDVPEDLDFLVPK
AGFFCPICSLFYSGEKAMTNHCKSTRHKQNTEKFMAKQRKEKEQNEAEERSSRSKYSCCT
NF
Download sequence
Identical sequences ENSFCAP00000004022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]